[BioRuby-cvs] bioruby/lib/bio/io ddbjxml.rb,1.8,1.9

Mitsuteru C. Nakao nakao at pub.open-bio.org
Sat Nov 26 04:37:13 EST 2005


Update of /home/repository/bioruby/bioruby/lib/bio/io
In directory pub.open-bio.org:/tmp/cvs-serv27574/lib/bio/io

Modified Files:
	ddbjxml.rb 
Log Message:
* Updated RDoc.


Index: ddbjxml.rb
===================================================================
RCS file: /home/repository/bioruby/bioruby/lib/bio/io/ddbjxml.rb,v
retrieving revision 1.8
retrieving revision 1.9
diff -C2 -d -r1.8 -r1.9
*** ddbjxml.rb	14 Nov 2005 02:01:54 -0000	1.8
--- ddbjxml.rb	26 Nov 2005 09:37:11 -0000	1.9
***************
*** 34,41 ****
--- 34,80 ----
  class DDBJ
  
+ 
+ # = Bio::DDBJ::XML
+ #
+ # Accessing the DDBJ web services at
+ #
+ # * http://xml.nig.ac.jp/
+ # * http://xml.nig.ac.jp/wsdl/index.jsp
+ #
  class XML < Bio::SOAPWSDL
  
    BASE_URI = "http://xml.nig.ac.jp/wsdl/"
  
+   # = Blast
+   #
+   # BLAST Database Search
+   #
+   # * http://xml.nig.ac.jp/doc/Blast.txt
+   #
+   # == Examples
+   #
+   #  serv = Bio::DDBJ::XML::Blast.new
+   #  query = "MSSRIARALALVVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQL"
+   #  
+   #  report = serv.searchSimple('blastp', 'SWISS', query)
+   #  Bio::Blast::Default::Report.new(report).each_hit do |hit|
+   #    hit.hsps.find_all {|x| x.evalue < 0.1 }.each do |hsp|
+   #      p [hsps.evalue, hsps.identity, hsps.definition]
+   #    end
+   #  end
+   #
+   #  puts serv.searchParam('tblastn', 'ddbjvrl', query, '-m 8')
+   # 
+   # == WSDL Methods
+   # 
+   # * searchSimple(program, database, query)
+   # Returns a blast report in the default format.
+   # * searchParam(program, database, query, param)
+   # Blasts with param and returns a blast report.
+   #
+   # == References
+   #
+   # * http://xml.nig.ac.jp/doc/Blast.txt
+   #
    class Blast < XML
      SERVER_URI = BASE_URI + "Blast.wsdl"
***************
*** 45,48 ****
--- 84,124 ----
    end
  
+ 
+   # == ClustalW
+   # 
+   # Multiple seaquece alignment using ClustalW.
+   #
+   # * http://xml.nig.ac.jp/doc/ClustalW.txt
+   #
+   # == Examples
+   #
+   #   serv = Bio::DDBJ::XML::ClustalW.new
+   #
+   #   query = <<END
+   #   > RABSTOUT   rabbit Guinness receptor
+   #   LKMHLMGHLKMGLKMGLKGMHLMHLKHMHLMTYTYTTYRRWPLWMWLPDFGHAS
+   #   ADSCVCAHGFAVCACFAHFDVCFGAVCFHAVCFAHVCFAAAVCFAVCAC
+   #   > MUSNOSE   mouse nose drying factor
+   #   mhkmmhkgmkhmhgmhmhglhmkmhlkmgkhmgkmkytytytryrwtqtqwtwyt
+   #   fdgfdsgafdagfdgfsagdfavdfdvgavfsvfgvdfsvdgvagvfdv
+   #   > HSHEAVEN    human Guinness receptor repeat
+   #   mhkmmhkgmkhmhgmhmhg   lhmkmhlkmgkhmgkmk  ytytytryrwtqtqwtwyt
+   #   fdgfdsgafdagfdgfsag   dfavdfdvgavfsvfgv  dfsvdgvagvfdv
+   #   mhkmmhkgmkhmhgmhmhg   lhmkmhlkmgkhmgkmk  ytytytryrwtqtqwtwyt
+   #   fdgfdsgafdagfdgfsag   dfavdfdvgavfsvfgv  dfsvdgvagvfdv
+   #   END
+   #
+   #   puts serv.analyzeSimple(query)
+   #   puts serv.analyzeParam(query, '-align -matrix=blosum')
+   #
+   # == WSDL Methods
+   #
+   # * analyzeSimple(query)
+   # * analyzeParam(query, param)
+   #
+   # == References
+   #
+   # * http://xml.nig.ac.jp/doc/ClustalW.txt
+   #
    class ClustalW < XML
      SERVER_URI = BASE_URI + "ClustalW.wsdl"
***************
*** 51,55 ****
      end
    end
!   
    class DDBJ < XML
      SERVER_URI = BASE_URI + "DDBJ.wsdl"
--- 127,161 ----
      end
    end
! 
! 
!   # = DDBJ
!   #
!   # Retrieves a sequence entry from the DDBJ DNA Data Bank Japan.
!   #
!   # * http://xml.nig.ac.jp/doc/DDBJ.txt
!   #
!   # == Examples
!   #
!   #   serv = Bio::DDBJ::XML::DDBJ.new
!   #   puts serv.getFFEntry('AB000050')
!   #   puts serv.getXMLEntry('AB000050')
!   #   puts serv.getFeatureInfo('AB000050', 'cds')
!   #   puts serv.getAllFeatures('AB000050')
!   #   puts serv.getRelatedFeatures('AL121903', '59000', '64000')
!   #   puts serv.getRelatedFeaturesSeq('AL121903', '59000', '64000')
!   #
!   # == WSDL Methods 
!   #
!   # * getFFEntry(accession)
!   # * getXMLEntry(accession)
!   # * getFeatureInfo(accession, feature)
!   # * getAllFeatures(accession)
!   # * getRelatedFeatures(accession, start, stop)
!   # * getRelatedFeaturesSeq(accession, start, stop)
!   #
!   # == References
!   #
!   # * http://xml.nig.ac.jp/doc/DDBJ.txt
!   #
    class DDBJ < XML
      SERVER_URI = BASE_URI + "DDBJ.wsdl"
***************
*** 58,62 ****
      end
    end
!   
    class Fasta < XML
      SERVER_URI = BASE_URI + "Fasta.wsdl"
--- 164,193 ----
      end
    end
! 
! 
!   # = Fasta
!   # 
!   # Searching database using the Fasta package.
!   #
!   # * http://xml.nig.ac.jp/doc/Fasta.txt
!   # 
!   # == Examples
!   #
!   #   serv = Bio::DDBJ::XML::Fasta.new
!   #   query = ">Test\nMSDGAVQPDG GQPAVRNERA TGSGNGSGGG GGGGSGGVGI"
!   #    
!   #   puts serv.searchSimple('fasta34', 'PDB', query)
!   #   query = ">Test\nAGCTTTTCATTCTGACTGCAACGGGCAATATGTCTCTGTGTGGATTAAAAAAAGAGTGTCTGATAGCAGC"
!   #   puts serv.searchParam('fastx34_t', 'PDB', query, '-n')
!   #
!   # == WSDL Methods
!   #
!   # * searchSimple(program, database, query)
!   # * searchParam(program, database, query, param)
!   #
!   # == References
!   #
!   # * http://xml.nig.ac.jp/doc/Fasta.txt
!   #
    class Fasta < XML
      SERVER_URI = BASE_URI + "Fasta.wsdl"
***************
*** 65,69 ****
      end
    end
!   
    class GetEntry < XML
      SERVER_URI = BASE_URI + "GetEntry.wsdl"
--- 196,249 ----
      end
    end
! 
! 
!   # = GetEntry
!   #
!   # Retrieves database entries.
!   #
!   # * http://xml.nig.ac.jp/doc/GetEntry.txt
!   #
!   # == Examples
!   #
!   #  serv = Bio::DDBJ::XML::GetEntry.new
!   #  puts serv.getDDBJEntry('AB000050')
!   #  puts serv. getPDBEntry('1AAR')
!   #
!   # == WSDL Methods
!   #
!   # * getEntry(database, var, param1, param2)
!   # * getEntry(database, var)
!   # * getDDBJEntry(accession)
!   # * getDDBJCONEntry(accession)
!   # * getDDBJVerEntry(accession)
!   # * getLocus_DDBJEntry(locus)
!   # * getGene_DDBJEntry(gene)
!   # * getProd_DDBJEntry(products)
!   # * getPID_DDBJEntry(pid)
!   # * getClone_DDBJEntry(clone)
!   # * getXML_DDBJEntry(accession)
!   # * getEMBLEntry(accession)
!   # * getSWISSEntry(accession)
!   # * getPIREntry(accession)
!   # * getPRFEntry(accession)
!   # * getPDBEntry(accession)
!   # * getQVEntry(accession)
!   # * getDADEntry(accession)
!   # * getPID_DADEntry(pid)
!   # * getFASTA_DDBJEntry(accession)
!   # * getFASTA_DDBJCONEntry(accession)
!   # * getFASTA_DDBJVerEntry(accession)
!   # * getFASTA_DDBJSeqEntry(accession, start, end)
!   # * getFASTA_DADEntry(accession)
!   # * getFASTA_PIREntry(accession)
!   # * getFASTA_SWISSEntry(accession)
!   # * getFASTA_PDBEntry(accession)
!   # * getFASTA_PRFEntry(accession)
!   # * getFASTA_CDSEntry(accession)
!   #
!   # == References
!   #
!   # * http://xml.nig.ac.jp/doc/GetEntry.txt
!   #
    class GetEntry < XML
      SERVER_URI = BASE_URI + "GetEntry.wsdl"
***************
*** 72,76 ****
      end
    end
!   
    class Gib < XML
      SERVER_URI = BASE_URI + "Gib.wsdl"
--- 252,296 ----
      end
    end
! 
! 
!   # = Gib
!   # 
!   # Genome Information broker
!   #
!   # * http://xml.nig.ac.jp/doc/Gib.txt
!   #
!   # == Examples
!   #
!   #   serv = Bio::DDBJ::XML::Gib.new
!   #   puts serv.getOrganismList
!   #   puts serv.getChIDList
!   #   puts serv.getOrganismNameFromChid('Sent_CT18:')
!   #   puts serv.getChIDFromOrganismName('Aquifex aeolicus VF5')
!   #   puts serv.getAccession('Ecol_K12_MG1655:')
!   #   puts serv.getPieceNumber('Mgen_G37:')
!   #   puts serv.getDivision('Mgen_G37:')
!   #   puts serv.getType('Mgen_G37:')
!   #   puts serv.getCDS('Aaeo_VF5:ece1')
!   #   puts serv.getFlatFile('Nost_PCC7120:pCC7120zeta')
!   #   puts serv.getFastaFile('Nost_PCC7120:pCC7120zeta', 'cdsaa')
!   #
!   # == WSDL Methods
!   #
!   # * getOrganismList
!   # * getChIDList
!   # * getOrganismNameFromChid(chid)
!   # * getChIDFromOrganismName(orgName)
!   # * getAccession(chid)
!   # * getPieceNumber(chid)
!   # * getDivision(chid)
!   # * getType(chid)
!   # * getFlatFile(chid)
!   # * getFastaFile(chid, type)
!   # * getCDS(chid)
!   #
!   # == References
!   #
!   # * http://xml.nig.ac.jp/doc/Gib.txt
!   #
    class Gib < XML
      SERVER_URI = BASE_URI + "Gib.wsdl"
***************
*** 80,83 ****
--- 300,325 ----
    end
  
+   
+   # = Gtop
+   #
+   # GTOP: Gene to protein.
+   #
+   # * http://xml.nig.ac.jp/doc/Gtop.txt
+   #
+   # == Examples
+   #
+   # serv = Bio::DDBJ::XML::Gtop.new
+   # puts serv.getOrganismList
+   # puts serv.getMasterInfo('thrA', 'ecol0')
+   #
+   # == WSDL Methods
+   #
+   # * getOrganismList
+   # * getMasterInfo(orfID, organism)
+   #
+   # == References
+   #
+   # * http://xml.nig.ac.jp/doc/Gtop.txt
+   #
    class Gtop < XML
      SERVER_URI = BASE_URI + "Gtop.wsdl"
***************
*** 87,90 ****
--- 329,357 ----
    end
  
+ 
+   # == PML
+   #
+   # Variation database
+   #
+   # * http://xml.nig.ac.jp/doc/PML.txt
+   # 
+   # == Examples
+   #
+   #  serv = Bio::DDBJ::XML::PML.new
+   #  puts serv.getVariation('1')
+   #
+   # == WSDL Methods
+   #
+   # * searchVariation(field, query, order)
+   # * searchVariationSimple(field, query)
+   # * searchFrequency(field, query, order)
+   # * searchFrequencySimple(field, query)
+   # * getVariation(variation_id)
+   # * getFrequency(variation_id, population_id)
+   #
+   # == References
+   #
+   # * http://xml.nig.ac.jp/doc/PML.txt
+   #
    class PML < XML
      SERVER_URI = BASE_URI + "PML.wsdl"
***************
*** 94,97 ****
--- 361,386 ----
    end
  
+ 
+   # = SRS
+   #
+   # Sequence Retrieving System
+   # 
+   # * http://xml.nig.ac.jp/doc/SRS.txt
+   # 
+   # == Examples
+   #
+   #  serv = Bio::DDBJ::XML::SRS.new
+   #  puts serv.searchSimple('[pathway-des:sugar]')
+   #  puts serv.searchParam('[swissprot-des:cohesin]', '-f seq -sf fasta')
+   #
+   # == WSDL Methods
+   #
+   # * searchSimple(query)
+   # * searchParam(query, param)
+   #
+   # == Examples
+   #
+   # * http://xml.nig.ac.jp/doc/SRS.txt
+   #
    class SRS < XML
      SERVER_URI = BASE_URI + "SRS.wsdl"
***************
*** 101,104 ****
--- 390,424 ----
    end
    
+ 
+   # = TxSearch
+   #
+   # Searching taxonomy information.
+   # 
+   # * http://xml.nig.ac.jp/doc/TxSearch.txt
+   #
+   # == Examples
+   #
+   #  serv = Bio::DDBJ::XML::TxSearch.new
+   #  puts serv.searchSimple('*coli')
+   #  puts serv.searchSimple('*tardigrada*')
+   #  puts serv.getTxId('Escherichia coli')
+   #  puts serv.getTxName('562')
+   #
+   #  query = ["Campylobacter coli", "Escherichia coli"].join("\n")
+   #  rank = ["family", "genus"].join("\n")
+   #  puts serv.searchLineage(query, rank, 'Bacteria')
+   #
+   # == WSDL Methdos
+   #
+   # * searchSimple(tx_Name)
+   # * searchParam(tx_Name, tx_Clas, tx_Rank, tx_Rmax, tx_Dcls)
+   # * getTxId(tx_Name)
+   # * getTxName(tx_Id)
+   # * searchLineage(query, ranks, superkingdom)
+   # 
+   # == References
+   #
+   # * http://xml.nig.ac.jp/doc/TxSearch.txt
+   #
    class TxSearch < XML
      SERVER_URI = BASE_URI + "TxSearch.wsdl"
***************
*** 292,425 ****
  
  end
- 
- 
- 
- =begin
- 
- = Bio::DDBJ::XML
- 
- Accessing the DDBJ web services at
- 
-   * ((<URL:http://xml.nig.ac.jp/>))
-   * ((<URL:http://xml.nig.ac.jp/wsdl/index.jsp>))
- 
- == Blast
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/Blast.txt>))
- 
- --- searchSimple(program, database, query)
- --- searchParam(program, database, query, param)
- 
- == ClustalW
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/ClustalW.txt>))
- 
- --- analyzeSimple(query)
- --- analyzeParam(query, param)
- 
- == DDBJ
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/DDBJ.txt>))
- 
- --- getFFEntry(accession)
- --- getXMLEntry(accession)
- --- getFeatureInfo(accession, feature)
- --- getAllFeatures(accession)
- --- getRelatedFeatures(accession, start, stop)
- --- getRelatedFeaturesSeq(accession, start, stop)
- 
- == Fasta
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/Fasta.txt>))
- 
- --- searchSimple(program, database, query)
- --- searchParam(program, database, query, param)
- 
- == GetEntry
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/GetEntry.txt>))
- 
- --- getEntry(database, var, param1, param2)
- --- getEntry(database, var)
- --- getDDBJEntry(accession)
- --- getDDBJCONEntry(accession)
- --- getDDBJVerEntry(accession)
- --- getLocus_DDBJEntry(locus)
- --- getGene_DDBJEntry(gene)
- --- getProd_DDBJEntry(products)
- --- getPID_DDBJEntry(pid)
- --- getClone_DDBJEntry(clone)
- --- getXML_DDBJEntry(accession)
- --- getEMBLEntry(accession)
- --- getSWISSEntry(accession)
- --- getPIREntry(accession)
- --- getPRFEntry(accession)
- --- getPDBEntry(accession)
- --- getQVEntry(accession)
- --- getDADEntry(accession)
- --- getPID_DADEntry(pid)
- --- getFASTA_DDBJEntry(accession)
- --- getFASTA_DDBJCONEntry(accession)
- --- getFASTA_DDBJVerEntry(accession)
- --- getFASTA_DDBJSeqEntry(accession, start, end)
- --- getFASTA_DADEntry(accession)
- --- getFASTA_PIREntry(accession)
- --- getFASTA_SWISSEntry(accession)
- --- getFASTA_PDBEntry(accession)
- --- getFASTA_PRFEntry(accession)
- --- getFASTA_CDSEntry(accession)
- 
- == Gib
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/Gib.txt>))
- 
- --- getOrganismList
- --- getChIDList
- --- getOrganismNameFromChid(chid)
- --- getChIDFromOrganismName(orgName)
- --- getAccession(chid)
- --- getPieceNumber(chid)
- --- getDivision(chid)
- --- getType(chid)
- --- getFlatFile(chid)
- --- getFastaFile(chid, type)
- --- getCDS(chid)
- 
- == Gtop
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/Gtop.txt>))
- 
- --- getOrganismList
- --- getMasterInfo(orfID, organism)
- 
- == PML
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/PML.txt>))
- 
- --- searchVariation(field, query, order)
- --- searchVariationSimple(field, query)
- --- searchFrequency(field, query, order)
- --- searchFrequencySimple(field, query)
- --- getVariation(variation_id)
- --- getFrequency(variation_id, population_id)
- 
- == SRS
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/SRS.txt>))
- 
- --- searchSimple(query)
- --- searchParam(query, param)
- 
- == TxSearch
- 
-   * ((<URL:http://xml.nig.ac.jp/doc/TxSearch.txt>))
- 
- --- searchSimple(tx_Name)
- --- searchParam(tx_Name, tx_Clas, tx_Rank, tx_Rmax, tx_Dcls)
- --- getTxId(tx_Name)
- --- getTxName(tx_Id)
- --- searchLineage(query, ranks, superkingdom)
- 
- =end
- 
  
--- 612,614 ----



More information about the bioruby-cvs mailing list