[Bioperl-l] load_seqdatabase.pl
Baohua Wang
bwang at tc.cornell.edu
Wed May 18 10:55:29 EDT 2005
Dear Hilmar,
I recently installed BioSQL on Windows and have the similar problem (not
use cygwin) and didn't find any solution on Web. Then I went one step
further by myself. It took me sometime to find out what's the problem.
The script failed on throw() in loading Bio/Root/Root.pm on Windows.
The problem lines are those "throw $class (...". After I put comma
after $class as "throw $class, (...", the BioSQL tests and load scripts
are succeeded
(ftp://ftp.tc.cornell.edu/Outgoing/bwang/bioperl/MSSQL/package-modificat
ion/perl/Bio/Root/Root.pm).
I wish someone can work through the Root.pm and do more test on
different Platforms and make some changes if necessary.
Best wishes,
Baohua Wang
________________________________
[Bioperl-l] load_seqdatabase.pl
Hilmar Lapp hlapp at gnf.org
<mailto:bioperl-l%40portal.open-bio.org?Subject=%5BBioperl-l%5D%20load_s
eqdatabase.pl&In-Reply-To=4052156E.2040402%40genetics.utah.edu>
Fri Mar 12 21:01:01 EST 2004
* Previous message: [Bioperl-l] load_seqdatabase.pl
<http://bioperl.org/pipermail/bioperl-l/2004-March/015235.html>
* Next message: [Bioperl-l] protein networks
<http://bioperl.org/pipermail/bioperl-l/2004-March/015236.html>
* Messages sorted by: [ date ]
<http://bioperl.org/pipermail/bioperl-l/2004-March/date.html#15240> [
thread ]
<http://bioperl.org/pipermail/bioperl-l/2004-March/thread.html#15240> [
subject ]
<http://bioperl.org/pipermail/bioperl-l/2004-March/subject.html#15240>
[ author ]
<http://bioperl.org/pipermail/bioperl-l/2004-March/author.html#15240>
________________________________
I have seen this before I believe from someone on a Windows machine.
The problem could be some trouble with the dynamic loading of modules.
The -d option to perl invokes the debugger. Do you see the same problem
without invoking the debugger?
Did the bioperl-db tests pass?
Root::debug() is invoked all over the place many many times. By
default, you won't see any of that since $obj->verbose() governs
whether the messages are printed or suppressed. You can try to pass
--debug to load_seqdatabase.pl and see when it crashes then. (All
messages that you see in addition after enabling --debug will have been
routed through Root::debug.)
-hilmar
On Friday, March 12, 2004, at 11:54 AM, Barry Moore wrote:
> I'm having some trouble with load_seqdatabase.pl. I using BioPerl 1.4
> (with some CVS updates including bioperl-db and bioperl-live Bio::DB
> yesterday), ActiveState Perl 5.8, MySQL version 12.22 distribution
> 4.0.16, Windows XP. I've successfully created a database mysql with
> the biosqldb-mysql.sql schema downloaded yesterday. I have a file
> RefSeq_Human_mRNA_short.gb that has RefSeq mRNA in GenBank format (I
> pasted the first record from that file below). I run
> load_seqdatabase.pl like this:
>
> >perl -d load_seqdatabase.pl --dbpass *******
> RefSeq_Human_mRNA_short.gb
>
> All of the script defaults should be O.K., but I've tried setting them
> all on the command line as well.
>
> The script opens the file, and gets sequence out of it O.K., but then
> somewhere in the eval statement that begins at line 500 it heads off
> to Bio::Root::Root, and loses the plot with this error:
>
> Undefined subroutine &Bio::Root::Root::debug called at
> C:/Perl/site/lib/Bio/DB/BioSQL/BasePersistenceAdaptor.pm line 1526,
> <GEN1> line 413.
>
Bio::DB::BioSQL::BasePersistenceAdaptor::_get_driver_class('Bio::DB::Bi
> o
>
SQL::SeqAdaptor=HASH(0x1d22200)','Bio::DB::BioSQL::mysql::','Driver','B
> io::DB::B
> ioSQL::SeqAdaptor') called at
> C:/Perl/site/lib/Bio/DB/BioSQL/BasePersistenceAdap
> tor.pm line 1507
>
Bio::DB::BioSQL::BasePersistenceAdaptor::dbd('Bio::DB::BioSQL::SeqAdapt
> o
> r=HASH(0x1d22200)') called at
> C:/Perl/site/lib/Bio/DB/BioSQL/BasePersistenceAdap
> tor.pm line 1386
>
Bio::DB::BioSQL::BasePersistenceAdaptor::rollback('Bio::DB::BioSQL::Seq
> A
> daptor=HASH(0x1d22200)') called at load_seqdatabase.pl line 524
>
> I'm happy to try to figure this out myself, but right now I haven't a
> clue what's going on since the subroutine &Bio::Root::Root::debug
> seems to me to be where it's supposed to be. Is this possible a OS
> issue since I'm on Windows? Can anyone nudge me in the right
> direction?
>
> Barry
> --
> Barry Moore
> Dept. of Human Genetics
> University of Utah
> Salt Lake City, UT
>
>
> LOCUS NM_000014 4577 bp mRNA linear PRI 20-DEC-2003
> DEFINITION Homo sapiens alpha-2-macroglobulin (A2M), mRNA.
> ACCESSION NM_000014
> VERSION NM_000014.3 GI:6226959
> KEYWORDS .
> SOURCE Homo sapiens (human)
> ORGANISM Homo sapiens
> Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
> Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo.
> REFERENCE 1 (bases 1 to 4577)
> AUTHORS Mathew,S., Arandjelovic,S., Beyer,W.F., Gonias,S.L. and
> Pizzo,S.V.
> TITLE Characterization of the interaction between alpha2-macroglobulin
> and fibroblast growth factor-2: the role of hydrophobic
> interactions
> JOURNAL Biochem. J. 374 (Pt 1), 123-129 (2003)
> PUBMED 12755687
> REMARK GeneRIF: FGF-2 and this protein interact at specific binding
> sites,
> involving different FGF-2 sequences.
> REFERENCE 2 (bases 1 to 4577)
> AUTHORS Athauda,S.B., Nishigai,M., Arakawa,H., Ikai,A., Ukai,M. and
> Takahashi,K.
> TITLE Inhibition of human pepsin and gastricsin by
alpha2-macroglobulin
> JOURNAL J Enzyme Inhib Med Chem 18 (3), 219-224 (2003)
> PUBMED 14506912
> REMARK GeneRIF: alpha2-macroglobulin inhibits human pepsin adn
> gastricsin
> REFERENCE 3 (bases 1 to 4577)
> AUTHORS Arandjelovic,S., Freed,T.A. and Gonias,S.L.
> TITLE Growth factor-binding sequence in human alpha2-macroglobulin
> targets the receptor-binding site in transforming growth
> factor-beta
> JOURNAL Biochemistry 42 (20), 6121-6127 (2003)
> PUBMED 12755614
> REMARK GeneRIF: alpha(2)M-derived peptides target the receptor-binding
> sequence in TGF-beta
> REFERENCE 4 (bases 1 to 4577)
> AUTHORS Shibata,M., Sakai,H., Sakai,E., Okamoto,K., Nishishita,K.,
> Yasuda,Y., Kato,Y. and Yamamoto,K.
> TITLE Disruption of structural and functional integrity of alpha
> 2-macroglobulin by cathepsin E
> JOURNAL Eur. J. Biochem. 270 (6), 1189-1198 (2003)
> PUBMED 12631277
> REMARK GeneRIF: These results suggest the possible involvement of
> cathepsin E in disruption of the structural and functional
> integrity of alpha 2-macroglobulin in the endolysosome system.
> REFERENCE 5 (bases 1 to 4577)
> AUTHORS Zappia,M., Cittadella,R., Manna,I., Nicoletti,G., Andreoli,V.,
> Bonavita,S., Gambardella,A. and Quattrone,A.
> TITLE Genetic association of alpha2-macroglobulin polymorphisms with
AD
> in southern Italy
> JOURNAL Neurology 59 (5), 756-758 (2002)
> PUBMED 12221172
> REMARK GeneRIF: Genetic association of alpha2-macroglobulin
> polymorphisms
> with Alzheimer's disease
> REFERENCE 6 (bases 1 to 4577)
> AUTHORS Ghebremedhin,E., Schultz,C., Thal,D.R., Del Tredici,K.,
> Rueb,U. and
> Braak,H.
> TITLE Genetic association of argyrophilic grain disease with
> polymorphisms in alpha-2 macroglobulin and low-density lipoprotein
> receptor-related protein genes
> JOURNAL Neuropathol Appl Neurobiol 28 (4), 308-313 (2002)
> PUBMED 12175343
> REMARK GeneRIF: Genetic association of argyrophilic grain disease with
> polymorphisms in alpha-2 macroglobulin.
> REFERENCE 7 (bases 1 to 4577)
> AUTHORS Kolodziej,S.J., Wagenknecht,T., Strickland,D.K. and
Stoops,J.K.
> TITLE The three-dimensional structure of the human alpha
> 2-macroglobulin
> dimer reveals its structural organization in the tetrameric native
> and chymotrypsin alpha 2-macroglobulin complexes
> JOURNAL J. Biol. Chem. 277 (31), 28031-28037 (2002)
> PUBMED 12015318
> REMARK GeneRIF: The three-dimensional structure of the dimer reveals
> its
> structural organization in the tetrameric native and chymotrypsin
> alpha 2-macroglobulin complexes.
> REFERENCE 8 (bases 1 to 4577)
> AUTHORS McElhinney,B., Ardill,J., Caldwell,C., Lloyd,F. and McClure,N.
> TITLE Ovarian hyperstimulation syndrome and assisted reproductive
> technologies: why some and not others?
> JOURNAL Hum. Reprod. 17 (6), 1548-1553 (2002)
> PUBMED 12042276
> REMARK GeneRIF: relationship between serum VEGF levels, alpha(2)M
> levels
> and the development of OHSS in hyperstimulated subjects undergoing
> IVF
> REFERENCE 9 (bases 1 to 4577)
> AUTHORS Mettenburg,J.M., Webb,D.J. and Gonias,S.L.
> TITLE Distinct binding sites in the structure of alpha 2-macroglobulin
> mediate the interaction with beta-amyloid peptide and growth
> factors
> JOURNAL J. Biol. Chem. 277 (15), 13338-13345 (2002)
> PUBMED 11823454
> REMARK GeneRIF: distinct binding sites mediate interaction with
> beta-amyloid peptide and growth factors
> REFERENCE 10 (bases 1 to 4577)
> AUTHORS Cvirn,G., Gallistl,S., Koestenberger,M., Kutschera,J.,
> Leschnik,B.
> and Muntean,W.
> TITLE Alpha 2-macroglobulin enhances prothrombin activation and
> thrombin
> potential by inhibiting the anticoagulant protein C/protein S
> system in cord and adult plasma
> JOURNAL Thromb. Res. 105 (5), 433-439 (2002)
> PUBMED 12062545
> REMARK GeneRIF: Alpha 2-macroglobulin enhances prothrombin activation
> and
> thrombin potential by inhibiting the anticoagulant protein
> C/protein S system in cord and adult plasma.
> REFERENCE 11 (bases 1 to 4577)
> AUTHORS Janka,Z., Juhasz,A., Rimanoczy,A., Boda,K., Marki-Zay,J.,
> Palotas,M., Kuk,I., Zollei,M., Jakab,K. and Kalman,J.
> TITLE Alpha2-macroglobulin exon 24 (Val-1000-Ile) polymorphism is not
> associated with late-onset sporadic Alzheimer's dementia in the
> Hungarian population
> JOURNAL Psychiatr. Genet. 12 (1), 49-54 (2002)
> PUBMED 11901360
> REMARK GeneRIF: has an important role in the AD-specific
> neurodegenerative
> process but its exon 24 Val-1000-Ile polymorphism is not likely to
> be associated with late-onset sporadic AD in the Hungarian
> population
> REFERENCE 12 (bases 1 to 4577)
> AUTHORS Chiabrando,G.A., Vides,M.A. and Sanchez,M.C.
> TITLE Differential binding properties of human pregnancy zone protein-
> and alpha2-macroglobulin-proteinase complexes to low-density
> lipoprotein receptor-related protein
> JOURNAL Arch. Biochem. Biophys. 398 (1), 73-78 (2002)
> PUBMED 11811950
> REMARK GeneRIF: Differential binding to ldl receptor related protein
> REFERENCE 13 (bases 1 to 4577)
> AUTHORS Toombs,C.F.
> TITLE Alfimeprase: pharmacology of a novel fibrinolytic
> metalloproteinase
> for thrombolysis
> JOURNAL Haemostasis 31 (3-6), 141-147 (2001)
> PUBMED 11910179
> REMARK GeneRIF: REVIEW: binds and neutralizes alfimeprase, which has
> direct proteolytic activity against the fibrinogen Aalpha chain
> REFERENCE 14 (bases 1 to 4577)
> AUTHORS Borth,W.
> TITLE Alpha 2-macroglobulin, a multifunctional binding protein with
> targeting characteristics
> JOURNAL FASEB J. 6 (15), 3345-3353 (1992)
> PUBMED 1281457
> REFERENCE 15 (bases 1 to 4577)
> AUTHORS Poller,W., Faber,J.P., Klobeck,G. and Olek,K.
> TITLE Cloning of the human alpha 2-macroglobulin gene and detection of
> mutations in two functional domains: the bait region and the
> thiolester site
> JOURNAL Hum. Genet. 88 (3), 313-319 (1992)
> PUBMED 1370808
> REFERENCE 16 (bases 1 to 4577)
> AUTHORS Poller,W., Faber,J.P. and Olek,K.
> TITLE Sequence polymorphism in the human alpha-2-macroglobulin (A2M)
> gene
> JOURNAL Nucleic Acids Res. 19 (1), 198 (1991)
> PUBMED 1707161
> REFERENCE 17 (bases 1 to 4577)
> AUTHORS Bell,G.I., Rall,L.B., Sanchez-Pescador,R., Merryweather,J.P.,
> Scott,J., Eddy,R.L. and Shows,T.B.
> TITLE Human alpha 2-macroglobulin gene is located on chromosome 12
> JOURNAL Somat. Cell Mol. Genet. 11 (3), 285-289 (1985)
> PUBMED 2408344
> REFERENCE 18 (bases 1 to 4577)
> AUTHORS Kan,C.C., Solomon,E., Belt,K.T., Chain,A.C., Hiorns,L.R. and
> Fey,G.
> TITLE Nucleotide sequence of cDNA encoding human alpha 2-macroglobulin
> and assignment of the chromosomal locus
> JOURNAL Proc. Natl. Acad. Sci. U.S.A. 82 (8), 2282-2286 (1985)
> PUBMED 2581245
> COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff.
> The
> reference sequence was derived from M11313.1.
> On Nov 4, 1999 this sequence version replaced gi:6226762.
>
> Summary: Alpha-2-macroglobulin is a protease inhibitor and cytokine
> transporter. It inhibits many proteases, including trypsin,
> thrombin and collagenase. A2M is implicated in Alzheimer disease
> (AD) due to its ability to mediate the clearance and degradation of
> A-beta, the major component of beta-amyloid deposits.
> FEATURES Location/Qualifiers
> source 1..4577
> /organism="Homo sapiens"
> /mol_type="mRNA"
> /db_xref="taxon:9606"
> /chromosome="12"
> /map="12p13.3-p12.3"
> gene 1..4577
> /gene="A2M"
> /db_xref="GeneID:2"
> /db_xref="LocusID:2"
> /db_xref="MIM:103950"
> CDS 44..4468
> /gene="A2M"
> /note="go_function: protein carrier activity [goid
> 0008320] [evidence NR];
> go_function: endopeptidase inhibitor activity [goid
> 0004866] [evidence NR];
> go_function: wide-spectrum protease inhibitor activity
> [goid 0017114] [evidence IEA];
> go_function: serine protease inhibitor activity [goid
> 0004867] [evidence IEA];
> go_function: alpha-2 macroglobulin [goid 0016975]
> [evidence NAS];
> go_process: intracellular protein transport [goid 0006886]
> [evidence NR]"
> /codon_start=1
> /product="alpha 2 macroglobulin precursor"
> /protein_id="NP_000005.1"
> /db_xref="GI:4557225"
> /db_xref="GeneID:2"
> /db_xref="LocusID:2"
> /db_xref="MIM:103950"
> /translation="MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETT
> EKGCVLLSYLNETVTVSASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMF
> LTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNE
> LIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHP
> FTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDAS
> DCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVE
> LTGRQSSEITRTITKLSFVKVDSHFRQGIPFFGQVRLVDGKGVPIPNKVIFIRGNEAN
> YYSNATTDEHGLVQFSINTTNVMGTSLTVRVNYKDRSPCYGYQWVSEEHEEAHHTAYL
> VFSPSKSFVHLEPMSHELPCGHTQTVQAHYILNGGTLLGLKKLSFYYLIMAKGGIVRT
> GTHGLLVKQEDMKGHFSISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDVENCLAN
> KVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAVDQSVLLMKPDAELSASSVYNLLPE
> KDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSK
> IRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWI
> WDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTM
> PYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVEKEQAPHCICANGRQTV
> SWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGLEKET
> TFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGC
> GEQNMVLFAPNIYVLDYLNETQQLTPEVKSKAIGYLNTGYQRQLNYKHYDGSYSTFGE
> RYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLN
> NAIKGGVEDEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDHGSHVYT
> KALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSA
> EVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALS
> KYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEG
> CVYLQTSLKYNILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNM
> AIVDVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQD
> VPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGNA"
> sig_peptide 44..112
> /gene="A2M"
> /note="alpha-2-macroglobulin signal peptide"
> misc_feature 104..4465
> /gene="A2M"
> /note="KOG1366; Region: Alpha-macroglobulin
> [Posttranslational modification, protein turnover,
> chaperones]"
> /db_xref="CDD:19155"
> misc_feature 110..1927
> /gene="A2M"
> /note="A2M_N; Region: Alpha-2-macroglobulin family
> N-terminal region"
> /db_xref="CDD:17056"
> mat_peptide 113..4465
> /gene="A2M"
> /product="alpha-2-macroglobulin"
> misc_feature 2216..4432
> /gene="A2M"
> /note="Region: Alpha-2-macroglobulin family"
> /db_xref="CDD:5952"
> variation 1122
> /gene="A2M"
> /replace="G"
> /replace="A"
> /db_xref="dbSNP:2229298"
> variation 1282
> /gene="A2M"
> /replace="T"
> /replace="C"
> /db_xref="dbSNP:1049134"
> variation 1339
> /gene="A2M"
> /replace="T"
> /replace="C"
> /db_xref="dbSNP:2228222"
> variation 1354
> /gene="A2M"
> /replace="G"
> /replace="A"
> /db_xref="dbSNP:226396"
> variation 1958
> /gene="A2M"
> /replace="G"
> /replace="A"
> /db_xref="dbSNP:226405"
> variation 2154
> /gene="A2M"
> /replace="G"
> /replace="A"
> /db_xref="dbSNP:1800434"
> variation 2431
> /gene="A2M"
> /replace="T"
> /replace="C"
> /db_xref="dbSNP:1049143"
> variation 2487
> /gene="A2M"
> /replace="T"
> /replace="A"
> /db_xref="dbSNP:3180392"
> variation 2487
> /gene="A2M"
> /replace="T"
> /replace="A"
> /db_xref="dbSNP:3210107"
> variation 2958
> /gene="A2M"
> /replace="G"
> /replace="A"
> /db_xref="dbSNP:1800433"
> variation 3041
> /gene="A2M"
> /replace="G"
> /replace="A"
> /db_xref="dbSNP:669"
> variation 3988
> /gene="A2M"
> /replace="G"
> /replace="A"
> /db_xref="dbSNP:1802964"
> variation 4334
> /gene="A2M"
> /replace="T"
> /replace="C"
> /db_xref="dbSNP:1802965"
> variation 4474
> /gene="A2M"
> /replace="C"
> /replace="A"
> /db_xref="dbSNP:1130840"
> variation 4508
> /gene="A2M"
> /replace="T"
> /replace="C"
> /db_xref="dbSNP:1049985"
> variation 4511
> /gene="A2M"
> /replace="T"
> /replace="A"
> /db_xref="dbSNP:1802966"
> variation 4519
> /gene="A2M"
> /replace="C"
> /replace="A"
> /db_xref="dbSNP:3190224"
> ORIGIN
> 1 gctacaatcc atctggtctc ctccagctcc ttctttctgc aacatgggga agaacaaact
> 61 ccttcatcca agtctggttc ttctcctctt ggtcctcctg cccacagacg cctcagtctc
> 121 tggaaaaccg cagtatatgg ttctggtccc ctccctgctc cacactgaga ccactgagaa
> 181 gggctgtgtc cttctgagct acctgaatga gacagtgact gtaagtgctt ccttggagtc
> 241 tgtcagggga aacaggagcc tcttcactga cctggaggcg gagaatgacg tactccactg
> 301 tgtcgccttc gctgtcccaa agtcttcatc caatgaggag gtaatgttcc tcactgtcca
> 361 agtgaaagga ccaacccaag aatttaagaa gcggaccaca gtgatggtta agaacgagga
> 421 cagtctggtc tttgtccaga cagacaaatc aatctacaaa ccagggcaga cagtgaaatt
> 481 tcgtgttgtc tccatggatg aaaactttca ccccctgaat gagttgattc cactagtata
> 541 cattcaggat cccaaaggaa atcgcatcgc acaatggcag agtttccagt tagagggtgg
> 601 cctcaagcaa ttttcttttc ccctctcatc agagcccttc cagggctcct acaaggtggt
> 661 ggtacagaag aaatcaggtg gaaggacaga gcaccctttc accgtggagg aatttgttct
> 721 tcccaagttt gaagtacaag taacagtgcc aaagataatc accatcttgg aagaagagat
> 781 gaatgtatca gtgtgtggcc tatacacata tgggaagcct gtccctggac atgtgactgt
> 841 gagcatttgc agaaagtata gtgacgcttc cgactgccac ggtgaagatt cacaggcttt
> 901 ctgtgagaaa ttcagtggac agctaaacag ccatggctgc ttctatcagc aagtaaaaac
> 961 caaggtcttc cagctgaaga ggaaggagta tgaaatgaaa cttcacactg aggcccagat
> 1021 ccaagaagaa ggaacagtgg tggaattgac tggaaggcag tccagtgaaa tcacaagaac
> 1081 cataaccaaa ctctcatttg tgaaagtgga ctcacacttt cgacagggaa ttcccttctt
> 1141 tgggcaggtg cgcctagtag atgggaaagg cgtccctata ccaaataaag tcatattcat
> 1201 cagaggaaat gaagcaaact attactccaa tgctaccacg gatgagcatg gccttgtaca
> 1261 gttctctatc aacaccacca acgttatggg tacctctctt actgttaggg tcaattacaa
> 1321 ggatcgtagt ccctgttacg gctaccagtg ggtgtcagaa gaacacgaag aggcacatca
> 1381 cactgcttat cttgtgttct ccccaagcaa gagctttgtc caccttgagc ccatgtctca
> 1441 tgaactaccc tgtggccata ctcagacagt ccaggcacat tatattctga atggaggcac
> 1501 cctgctgggg ctgaagaagc tctcctttta ttatctgata atggcaaagg gaggcattgt
> 1561 ccgaactggg actcatggac tgcttgtgaa gcaggaagac atgaagggcc atttttccat
> 1621 ctcaatccct gtgaagtcag acattgctcc tgtcgctcgg ttgctcatct atgctgtttt
> 1681 acctaccggg gacgtgattg gggattctgc aaaatatgat gttgaaaatt gtctggccaa
> 1741 caaggtggat ttgagcttca gcccatcaca aagtctccca gcctcacacg cccacctgcg
> 1801 agtcacagcg gctcctcagt ccgtctgcgc cctccgtgct gtggaccaaa gcgtgctgct
> 1861 catgaagcct gatgctgagc tctcggcgtc ctcggtttac aacctgctac cagaaaagga
> 1921 cctcactggc ttccctgggc ctttgaatga ccaggacgat gaagactgca tcaatcgtca
> 1981 taatgtctat attaatggaa tcacatatac tccagtatca agtacaaatg aaaaggatat
> 2041 gtacagcttc ctagaggaca tgggcttaaa ggcattcacc aactcaaaga ttcgtaaacc
> 2101 caaaatgtgt ccacagcttc aacagtatga aatgcatgga cctgaaggtc tacgtgtagg
> 2161 tttttatgag tcagatgtaa tgggaagagg ccatgcacgc ctggtgcatg ttgaagagcc
> 2221 tcacacggag accgtacgaa agtacttccc tgagacatgg atctgggatt tggtggtggt
> 2281 aaactcagca ggggtggctg aggtaggagt aacagtccct gacaccatca ccgagtggaa
> 2341 ggcaggggcc ttctgcctgt ctgaagatgc tggacttggt atctcttcca ctgcctctct
> 2401 ccgagccttc cagcccttct ttgtggagct tacaatgcct tactctgtga ttcgtggaga
> 2461 ggccttcaca ctcaaggcca cggtcctaaa ctaccttccc aaatgcatcc gggtcagtgt
> 2521 gcagctggaa gcctctcccg ccttccttgc tgtcccagtg gagaaggaac aagcgcctca
> 2581 ctgcatctgt gcaaacgggc ggcaaactgt gtcctgggca gtaaccccaa agtcattagg
> 2641 aaatgtgaat ttcactgtga gcgcagaggc actagagtct caagagctgt gtgggactga
> 2701 ggtgccttca gttcctgaac acggaaggaa agacacagtc atcaagcctc tgttggttga
> 2761 acctgaagga ctagagaagg aaacaacatt caactcccta ctttgtccat caggtggtga
> 2821 ggtttctgaa gaattatccc tgaaactgcc accaaatgtg gtagaagaat ctgcccgagc
> 2881 ttctgtctca gttttgggag acatattagg ctctgccatg caaaacacac aaaatcttct
> 2941 ccagatgccc tatggctgtg gagagcagaa tatggtcctc tttgctccta acatctatgt
> 3001 actggattat ctaaatgaaa cacagcagct tactccagag gtcaagtcca aggccattgg
> 3061 ctatctcaac actggttacc agagacagtt gaactacaaa cactatgatg gctcctacag
> 3121 cacctttggg gagcgatatg gcaggaacca gggcaacacc tggctcacag cctttgttct
> 3181 gaagactttt gcccaagctc gagcctacat cttcatcgat gaagcacaca ttacccaagc
> 3241 cctcatatgg ctctcccaga ggcagaagga caatggctgt ttcaggagct ctgggtcact
> 3301 gctcaacaat gccataaagg gaggagtaga agatgaagtg accctctccg cctatatcac
> 3361 catcgccctt ctggagattc ctctcacagt cactcaccct gttgtccgca atgccctgtt
> 3421 ttgcctggag tcagcctgga agacagcaca agaaggggac catggcagcc atgtatatac
> 3481 caaagcactg ctggcctatg cttttgccct ggcaggtaac caggacaaga ggaaggaagt
> 3541 actcaagtca cttaatgagg aagctgtgaa gaaagacaac tctgtccatt gggagcgccc
> 3601 tcagaaaccc aaggcaccag tggggcattt ttacgaaccc caggctccct ctgctgaggt
> 3661 ggagatgaca tcctatgtgc tcctcgctta tctcacggcc cagccagccc caacctcgga
> 3721 ggacctgacc tctgcaacca acatcgtgaa gtggatcacg aagcagcaga atgcccaggg
> 3781 cggtttctcc tccacccagg acacagtggt ggctctccat gctctgtcca aatatggagc
> 3841 cgccacattt accaggactg ggaaggctgc acaggtgact atccagtctt cagggacatt
> 3901 ttccagcaaa ttccaagtgg acaacaacaa tcgcctgtta ctgcagcagg tctcattgcc
> 3961 agagctgcct ggggaataca gcatgaaagt gacaggagaa ggatgtgtct acctccagac
> 4021 ctccttgaaa tacaatattc tcccagaaaa ggaagagttc ccctttgctt taggagtgca
> 4081 gactctgcct caaacttgtg atgaacccaa agcccacacc agcttccaaa tctccctaag
> 4141 tgtcagttac acagggagcc gctctgcctc caacatggcg atcgttgatg tgaagatggt
> 4201 ctctggcttc attcccctga agccaacagt gaaaatgctt gaaagatcta accatgtgag
> 4261 ccggacagaa gtcagcagca accatgtctt gatttacctt gataaggtgt caaatcagac
> 4321 actgagcttg ttcttcacgg ttctgcaaga tgtcccagta agagatctca aaccagccat
> 4381 agtgaaagtc tatgattact acgagacgga tgagtttgca atcgctgagt acaatgctcc
> 4441 ttgcagcaaa gatcttggaa atgcttgaag accacaaggc tgaaaagtgc tttgctggag
> 4501 tcctgttctc tgagctccac agaagacacg tgtttttgta tctttaaaga cttgatgaat
> 4561 aaacactttt tctggtc
> //
>
>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l at portal.open-bio.org
<http://portal.open-bio.org/mailman/listinfo/bioperl-l>
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>
--
-------------------------------------------------------------
Hilmar Lapp email: lapp at gnf.org
GNF, San Diego, Ca. 92121 phone: +1-858-812-1757
-------------------------------------------------------------
More information about the Bioperl-l
mailing list