[Bioperl-l] Re: translation using Bioperl
Ewan Birney
birney@ebi.ac.uk
Tue, 25 Jul 2000 16:38:53 +0100 (GMT)
On Tue, 25 Jul 2000, Heikki Lehvaslaiho wrote:
> Dear Jonathan,
>
> Thanks for persisting. I learned something new. (I had to check it
> with a
> couple of experts before I believed!)
>
> To summarize: The amino acid that starts a polypeptide in translation
> process is always methionin, even if an alternative initiator codon is
> used. That means that even when using the standard codon table, the
> correct translation of the sequence 'AGT TGA ...' is 'MV...'.
>
> I've fixed this in bioperl live and 06 CVS branches.
>
> If you want to catch those cases where translation is NOT started by a
> valid initiator codon, you can now set ->verbose to true in your
> PrimarySeq object and it will warn you.
Heikki -
Can we watch the ->verbose attribute. This will have to be in on
Bio::PrimarySeqI --- and i would prefer we did not burden other
implementations with having to set this.
Would it be ok to let translate (optionally) take a verbose argument on
the function call?
>
> -Heikki
>
> "Lin, Xiaoying Jonathan" wrote:
> >
> > Dear Heikki,
> >
> > Thanks for the reply. The problem I encountered was exactly with the
> > alternative initiator codons.
> > The codon 'CTG', when at initiator position, should encode 'M' not 'L'
> > according to GenBank.
> >
> > http://www.ncbi.nlm.nih.gov/htbin-post/Taxonomy/wprintgc?mode=c#SG11
> >
> > I am wondering if your module translate those GUG, UUG, AUU, CUG at first
> > codon into 'M'?
> > If not, whether there should be a flag to set to do so....
> >
> > Thanks for the help and bioperl.
> >
> > --X. Jonathan Lin || Celera Genomics/Chrom Team || 240-453-3695
> >
> > > -----Original Message-----
> > > From: Heikki Lehvaslaiho [mailto:heikki@ebi.ac.uk]
> > > Sent: Tuesday, July 25, 2000 4:53 AM
> > > To: Lin, Xiaoying Jonathan
> > > Subject: Re: translation using Bioperl
> > >
> > >
> > >
> > > Dear Jonathan,
> > >
> > > The program works as it should. The bacterial codon table 11 is in
> > > fact identical to 1 except that is defines several new alternative
> > > initiator codons:
> > >
> > > http://www.ebi.ac.uk/cgi-bin/mutations/trtables.cgi?id=11&Action=Show
> > >
> > > The reason for this confusing state of affairs is that these codon
> > > tables have been devised to give slightly simplified taxonomic view of
> > > translation machinery in all living organisms. Have a look at the the
> > > NCBI Genetic Codes home page for more details:
> > >
> > > http://www.ncbi.nlm.nih.gov/htbin-post/Taxonomy/wprintgc?mode=c
> > >
> > > Yours,
> > >
> > > -Heikki
> > >
> > > P.S. I'll add a comment on this into CodonTable.pm
> > >
> > > "Lin, Xiaoying Jonathan" wrote:
> > > >
> > > > Hi,
> > > >
> > > > I am having a problem when using your module to translate a
> > > microbial gene.
> > > > With codon table 11
> > > > The script I wrote will pass the codon_table_id 11 to the
> > > your 'translation
> > > > method', but what I got back is from still the standard default.
> > > > I am not sure what I did wrong. Could you help?
> > > >
> > > > Thanks very much.
> > > >
> > > > --X. Jonathan Lin || Celera Genomics/Chrom Team || 240-453-3695
> > > >
> > > > #!/usr/local/bin/perl
> > > >
> > > > # my translation, a free stand tool
> > > > # mytrans <condon tableid> <fastafile>
> > > >
> > > > use lib "/work/chrom/users/linxj/lib/local_pm/";
> > > >
> > > > use Bio::SeqIO;
> > > > use Bio::PrimarySeq;
> > > >
> > > > $codon_tblid= $ARGV[0];
> > > > $myfile = $ARGV[1];
> > > >
> > > > $seqio = Bio::SeqIO->new ( '-format' => 'Fasta' , -file =>
> > > $myfile);
> > > >
> > > > while ($seqobj = $seqio->next_seq()) {
> > > > $aaobj = $seqobj->translate('*', 'X', 0, $codon_tblid);
> > > >
> > > > $len = $aaobj->length();
> > > > $seq = $aaobj->seq();
> > > >
> > > > print ">" . $aaobj->id ."\n";
> > > > for ($i=0; $i< $len; $i+= 60) {
> > > > print substr($seq, $i, 60),"\n"; #
> > > > }
> > > > }
> > > >
> > > > __END__
> > > >
> > > > cat cds
> > > >
> > > > >cds
> > > >
> > > CTGAATAAAAAGAAGACGCTGTACTTTGGTGCCGGTTGGTTTAATGAAAAGCAAAACAAAGCTTACAAAG
> > > >
> > > AAGCAATGGCAGCTTTAAAAGAAAATCCAACAGTTGATTTAGAAAATAGTTATGTGCCCCTTGAAAACCA
> > > >
> > > ATACAAGGGTATTCGCATTGATGAGCATCCACAGTACTTGCACAACATTGAATGGGCTTCTGCAACCTAC
> > > >
> > > CACAATGATTTAGTAGGAATTAAGACTTCTGATGTCCTGCTTGGCGTATATCTGCCACAAGAAGAACACG
> > > >
> > > TCGGCTTAGGCATGGAACTGGGCTACCCATTATCTCAAGGAAAATTATTTTTTTGGTTTTCCCATATGAA
> > > >
> > > AGATTACGGCAAGCCAATCATCTTAATGAGCTGGGGCGTTTGTGACAATGCCAGTCAGATCAGTGAATTA
> > > > AAAGACTTCGACTTTAACAAGCCTCGCTACAATTTCTACGACGGAGCTGTATATTAA
> > > >
> > > > linxj@chmap (82) mytrans 11 cds
> > > > >cds
> > > > LNKKKTLYFGAGWFNEKQNKAYKEAMAALKENPTVDLENSYVPLENQYKGIRIDEHPQYL
> > > > HNIEWASATYHNDLVGIKTSDVLLGVYLPQEEHVGLGMELGYPLSQGKLFFWFSHMKDYG
> > > > KPIILMSWGVCDNASQISELKDFDFNKPRYNFYDGAVY
> > >
> > > --
> > > ______ _/ _/_____________________________________________________
> > > _/ _/ http://www.ebi.ac.uk/mutations/
> > > _/ _/ _/ Heikki Lehvaslaiho heikki@ebi.ac.uk
> > > _/_/_/_/_/ EMBL Outstation, European Bioinformatics Institute
> > > _/ _/ _/ Wellcome Trust Genome Campus, Hinxton
> > > _/ _/ _/ Cambs. CB10 1SD, United Kingdom
> > > _/ Phone: +44 (0)1223 494 644 FAX: +44 (0)1223 494 468
> > > ___ _/_/_/_/_/________________________________________________________
> > >
>
> --
> ______ _/ _/_____________________________________________________
> _/ _/ http://www.ebi.ac.uk/mutations/
> _/ _/ _/ Heikki Lehvaslaiho heikki@ebi.ac.uk
> _/_/_/_/_/ EMBL Outstation, European Bioinformatics Institute
> _/ _/ _/ Wellcome Trust Genome Campus, Hinxton
> _/ _/ _/ Cambs. CB10 1SD, United Kingdom
> _/ Phone: +44 (0)1223 494 644 FAX: +44 (0)1223 494 468
> ___ _/_/_/_/_/________________________________________________________
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@bioperl.org
> http://bioperl.org/mailman/listinfo/bioperl-l
>
-----------------------------------------------------------------
Ewan Birney. Mobile: +44 (0)7970 151230, Work: +44 1223 494420
<birney@ebi.ac.uk>.
-----------------------------------------------------------------