[MOBY-dev] non-compliant services
Edward Kawas
edward.kawas at gmail.com
Tue Feb 14 16:09:13 UTC 2006
Hi Martin,
I don't think that it is possible to weed those services out, because moby
just keeps track of service signatures (inputs/outputs, service details,
etc). It is up to the provider to structure the service and its logic
according to the api.
The best that we can do is email the service provider and request that they
fix the service. If they don't, the service will ultimately 'remove' itself,
since other moby services will not be able to interact with it.
Eddie
> -----Original Message-----
> From: moby-dev-bounces at biomoby.org
> [mailto:moby-dev-bounces at biomoby.org] On Behalf Of Martin Senger
> Sent: Tuesday, February 14, 2006 7:57 AM
> To: Moby Developers
> Subject: [MOBY-dev] non-compliant services
>
> I wonder (I forgot it) what was the decision, after the big
> change regarding not inheriting from primitive types, what
> to do and when with services that do not comply with the new
> specification. I think that the discussion was about what to
> do with old data types, there was even a script to rectify
> them semi-automatically, but I do not recall what we said
> about the services.
> An example is a service getFASTAFromUniprot - a nice,
> fast, possibly reliable and important service, but it returns
> something like this:
>
> <?xml version='1.0' encoding='UTF-8'?><moby:MOBY
> xmlns:moby='http://www.biomoby.org/moby'
> xmlns='http://www.biomoby.org/moby'><moby:mobyContent
> moby:authority='mmb.pcb.ub.es'>
> <moby:mobyData moby:queryID='sip_1_'>
> <moby:Simple moby:articleName=''><FASTA namespace=''
> id='Q7T7Q6'><![CDATA[>Q7T7Q6_9REOV (Q7T7Q6) Sigma C
> (Fragment)
> AGLNPSQRREVVSLILSLTSNVTISHGDLTPIYERLTNLEASTELLHRSISDISTTVSNI
> SASLQDMTHTLDDVTANLDGLRTTVTALQDSVSILSTNVTDLTNTSSAHAATLSSLQTTV
> DGNSTAISNLKSDVSSNGLAITDLQDRVKSLESTASHGLSFSPPLSVADGVVSLDMDPYF
> CSQRVSLTSYPAEAQLMQFRWMARGTNGSSDTIDMTVNAHCHGRRTDYMMSSTGNLTVTS
> NVVLLTFDLSDITHIPSDLARLVPSAGFQAASFPVDVSFTRDSATHAYQAYGVYSSSRVF
> TITFPTGGDGTA
> ]]></FASTA></moby:Simple>
> </moby:mobyData>
> </moby:mobyContent></moby:MOBY>
>
> which is, according my limited knowledge wrong (the FASTA
> should have a String with the value there).
>
> Are we going to remove one day such services from a registry?
>
> Cheers,
> Martin
>
> --
> Martin Senger
> email: martin.senger at gmail.com
> skype: martinsenger
> consulting for:
> International Rice Research Institute
> Biometrics and Bioinformatics Unit
> DAPO BOX 7777, Metro Manila
> Philippines, phone: +63-2-580-5600 (ext.2324)
>
> _______________________________________________
> MOBY-dev mailing list
> MOBY-dev at biomoby.org
> http://biomoby.org/mailman/listinfo/moby-dev
More information about the MOBY-dev
mailing list