[Bioperl-l] problem with bp_genbank2gff.pl
Fields, Christopher J
cjfields at illinois.edu
Fri Nov 29 20:34:43 UTC 2013
The latest CPAN release (v 1.6.922) fixes these issues.
chris
On Nov 28, 2013, at 1:08 AM, zhou li <zhouli at tll.org.sg<mailto:zhouli at tll.org.sg>> wrote:
Dear Bioperl people,
I am using BioPerl-1.6.1, and the operating system is Mac OS X version 10.8.5.
I am trying to convert a local GenBank file to GFF file using bp_genbank2gff.pl, using the following command,
$ bp_genbank2gff.pl M21017.gb --stdout > M21017.gff3
And I got the following message, I am not sure if this is an error:
Replacement list is longer than search list at /Users/zhouli/perl5/perlbrew/perls/perl-5.18.1/lib/site_perl/5.18.1/Bio/Range.pm line 251.
UNIVERSAL->import is deprecated and will be removed in a future perl at /Users/zhouli/perl5/perlbrew/perls/perl-5.18.1/lib/site_perl/5.18.1/Bio/Tree/TreeFunctionsI.pm line 94.
# working on region:M21017, Drosophila melanogaster, 09-MAY-1994, D.melanogaster 18S, 5.8S 2S and 28S rRNA genes, complete, and 18S rRNA gene, 5' end, clone pDm238.
***************************************************************************
And the output file M21017.gff3 is attached.
$head M21017.gff3
##gff-version 3
M21017 Genbank region 1 12026 . . . ID=M21017;Note=D.melanogaster%2018S%2C%205.8S%202S%20and%2028S%20rRNA%20genes%2C%20complete%2C%20and%2018S%20rRNA%20gene%2C%205%27%20end%2C%20clone%20pDm238.;Alias=M29800
M21017 Genbank region 1 12026 . + . ID=Drosophila%20melanogaster;db_xref=taxon%3A7227;mol_type=genomic%20DNA
M21017 Genbank gene 1 12026 . + . ID=18S%20rRNA
M21017 Genbank RNA 1 7232 . + . ID=18S%20rRNA;note=rRNA%20primary%20transcript
M21017 Genbank rRNA 1 1995 . + . ID=18S%20rRNA;product=18S%20ribosomal%20RNA
M21017 Genbank gene 2722 2844 . + . ID=5.8S%20rRNA
M21017 Genbank rRNA 2722 2844 . + . ID=5.8S%20rRNA;product=5.8S%20ribosomal%20RNA
M21017 Genbank gene 2873 2902 . + . ID=2S%20rRNA
M21017 Genbank rRNA 2873 2902 . + . ID=2S%20rRNA;product=2S%20ribosomal%20RNA
When I test another genbank file
$ bp_genbank2gff.pl WSSV-AF369029-GenBank.gb --stdout > WSSV-AF369029-GenBank.gff3
I also got the error message:
Replacement list is longer than search list at /Users/zhouli/perl5/perlbrew/perls/perl-5.18.1/lib/site_perl/5.18.1/Bio/Range.pm line 251.
UNIVERSAL->import is deprecated and will be removed in a future perl at /Users/zhouli/perl5/perlbrew/perls/perl-5.18.1/lib/site_perl/5.18.1/Bio/Tree/TreeFunctionsI.pm line 94.
$ head WSSV-AF369029-GenBank.gff3
##gff-version 3
AF369029 Genbank region 1 292967 . . . ID=AF369029;Alias=AY864671;Note=White%20spot%20syndrome%20virus%2C%20complete%20genome.
AF369029 Genbank region 1 292967 . + . ID=White%20spot%20syndrome%20virus;mol_type=genomic%20DNA;isolate=WSSV-TH;country=Thailand;db_xref=taxon%3A342409
AF369029 Genbank gene 1 615 . + . ID=VP28;experiment=experimental%20evidence%2C%20no%20additional%20details%20recorded;note=envelope%20protein
AF369029 Genbank CDS 1 615 . + . Parent=VP28.t00;translation=MDLSFTLSVVSAILAITAVIAVFIVIFRYHNTVTKTIETHTDNIETNMDENLRIPVTAEVGSGYFKMTDVSFDSDTLGKIKIRNGKSDAQMKEEDADLVITPVEGRALEVTVGQNLTFEGTFKVWNNTSRKINITGMQMVPKINPSKAFVGSSNTSSFTPVSIDEDEVGTFVCGTTFGAPIAATAGGNLFDMYVHVTYSGTETE;db_xref=GI%3A15021393;protein_id=AAK77670.1;product=ORF1%2C%20VP28%2C%20gene%20family%201;note=envelope%20protein;codon_start=1
AF369029 Genbank CDS 710 2902 . - . Parent=AAK77671.1.t00;translation=MEGGDQRTKLTPATVMGLYQSKTPGEGEGGEGGGQFKIPSAIAVKSCCSKNATRRSPPSDSPYSLRPMKRLKKNNGEVGGKAPPPVTLRLREDYESTPYNFNRNKKKRPITIDENQFATLNPTYATDIIKKQQLPSVSAASVLRKHRANADTQYRKRFSHPNCAKFSTVNLKARDYTPLSVLRSHVKGPKHLKSSCDTVTETNVVKRNFSSIDKWVKLEKPPCYFAVAEADTNIAAGLESPFHLIRQAAKLGLISDVQDVSSNYETIKQSCIDAKEKASKFLWSNNRTKQPPSSWWPVGFGSKNLSVLDTSPLLNWNRLCKNNGKGWIKTMSIDHMAKNVFKLSPGACESILEKKTTLLGEVTAQCKKWESYRRNIPVPAHVQPEYASQVVMIGPSELYLEVKVGVYYMLETGKVIKFMTDKEMYCEFVFETVFSHALEGRMKGAVGVRKMCVEGFCVEMDFAGISVIDVLNGDLKCKMDENVVQQPNPSTTSSKPAAELMQDHGSLCRMRDTLYGVRMLQATGRLPEGLQSKCKKPITDSISAIAIVGKMRERMLNQLPFVLVEIVNIVTRLSQQGLVNPDIKSDNIVIDGITGQPKMIDFGLIVPCKKYYNFKCWGTDERFFSNHPHTAPEFINSELCSETAMTFGLAYLLIDMLSILIKRTADLSANSIYTNIPFLSIVSKMYDQEKTNRPRAYEIAPVIGACFPFKDNIAKLFQSPKHSLYSKKVK;db_xref=GI%3A15021394;codon_start=1;product=ORF2%2C%20putative%20serine%2Fthreonine%20protein%20kinase%20%28PK1%29%2C%20gene%20family%202
AF369029 Genbank CDS 3118 4989 . - . Parent=AAK77672.1.t00;codon_start=1;product=ORF3;db_xref=GI%3A15021395;translation=MAWTVMALKDAFTERLVVNKVGSGTDMAPVVEDDRQKSLFQKVENLYRVLVVEQKNSAITLSGNKNTNKRQCRQVEEDKVIFEGEDRTVSNLPQAVKETIAANAESILDYWYKNVIPLLDTKKERSGKSDTFLRTAVICLVRCCVSYKDMKTCSLIYEFEHKILNKSTLDPLLKDILDNKQELLHMDSKYGSKTTSPELAKETIEALYTTVYNHWTNAFKLYQASLTHKPVTGKKYASVIHFIRTWRKIVKAYVSKHNNVERDLSLKNIMKNESADNANVLTIEKMYKKIGNSVKNTNNNSAHQMSDSEDDDDDDDDDCEGMDVCDEASEREKKHQESLYPINTPVTTITGDYIFKVLLELVLSPHIHPEWKIPMCDFVNRNIPKLMKAMETDISNAVIEVRASKVNPVQILPIAANFWDFCKSGKPPSDVKFCMMFNEPSSNETLSSGAGVFGRFIGGPFSHKSKELDIISNCLRSLLLNKEADNLSTRIWREGGSVVCFNYCPITARGAVLGYGEQLSERSIKALWAKKIQDAVTESVKRQRNAADKNSRNCDLLGDEGVVSMKTVTFGCANMLKTQNGMGKFNVVVSFEDSIQANKEGAARQYMSQQVFTHSFPALDQGK
The output file is so tedious, the translation is all showing up. But to me, it is not needed.
1. Is there any way to make the output file more succinct without having the translation included?
2. Also, is there any way to split the output file to two files, one is the GFF3 file and the other one is DNA fasta sequence file?
3. When I import the WSSV-AF369029-GenBank.gff3 file to IGV, it displays the protein ID if there is no gene name for the sequence, e.g. those with feature "CDS" display the protein ID, and those with feature "gene" display gene ID, is this the way it works? I want to display the ORF ID, what should I do?
[TLL Conference]<http://conference.tll.org.sg/>
TLL is organizing an international conference on Next Generation Genomic
View on Plants, Animals and Microbes on March 5th to 7th, 2014. For more
information, please visit http://conference.tll.org.sg<http://conference.tll.org.sg/>
--------------------------------------------------------------------------------
Information in this email is confidential and may also be privileged. It is intended
solely for the person to whom it is addressed. If you are not the intended recipient,
please notify the sender, and please delete the message and any other record of it
from your system immediately.
Your help is greatly appreciated.
Thank you very much!
Regards,
Zhou Li
<PastedGraphic-1.pdf><M21017.gff3><WSSV-AF369029-GenBank.gff3>
More information about the Bioperl-l
mailing list