[Bioperl-l] Phyloxml SeqI without actual sequence
miraceti
miraceti at gmail.com
Tue Jul 29 17:31:57 UTC 2008
sometimes the clade looks like.
<sequence>
<annotation>
<desc>alcohol dehydrogenase</desc>
<confidence type="probability">0.99</confidence>
</annotation>
</sequence>
sometimes the clade looks like.
<sequence>
<symbol>ADHX</symbol>
<accession source="UniProtKB">P81431</accession>
<name>Alcohol dehydrogenase class-3</name>
<mol_seq>TDATGKPIKCMAAIAWEAKKPLSIEEVEVAPPKSGEVRIKILHSGVCHTD</mol_seq>
<annotation ref="EC:1.1.1.1"/>
<annotation ref="GO:0004022"/>
</sequence>
Do you think it's better not to create the SeqI in the first case?.
On Tue, Jul 29, 2008 at 12:51 PM, Jason Stajich <jason at bioperl.org> wrote:
> So why would you create the sequence in the first place when it is empty?
> Shouldn't you just not create a sequence if there isn't one? Can you provide
> sample data so we understand better - maybe there is sequence name but no
> data? Maybe we can specify an option to not warn when creating a sequence
> if a specific flag is provided to the Seq initialization routine.
>
> -jason
>
>
> On Jul 29, 2008, at 9:13 AM, Han, Mira wrote:
>
>
>> Another phyloxml parsing question.
>> We have <Sequence> tags that sometimes have actual molecular sequences and
>> sometimes don't.
>> I decided to create a SeqI object and link it to AnnotatableNode.
>> But when it doesn't have actual sequence
>> It gives warning that the sequence is empty.
>> I don't think it's a big problem,
>> And I'd prefer having consistency than having two different solutions for
>> the same tag.
>> But I'd like to hear people's opinion on this as well.
>> Thank you
>>
>> Mira Han
>>
>>
>> _______________________________________________
>> Bioperl-l mailing list
>> Bioperl-l at lists.open-bio.org
>> http://lists.open-bio.org/mailman/listinfo/bioperl-l
>>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l at lists.open-bio.org
> http://lists.open-bio.org/mailman/listinfo/bioperl-l
>
More information about the Bioperl-l
mailing list