[Biojava-l] java.lang.ExceptionInInitializerError in protein disorder module, JRonn
Srikanth Bezawada
srikanth.5283 at gmail.com
Wed Mar 1 21:18:11 UTC 2017
Hi BioJava,
I get the following stack trace when I try to find disorder scores using
biojava protein disorder module. Can you please let me know the fix ?
Thanks in advance.
Exception in thread "main" java.lang.ExceptionInInitializerError
at biojavausage.BioJavaUsage.main(BioJavaUsage.java:*25*)
Caused by: java.util.InputMismatchException
at java.util.Scanner.throwFor(Scanner.java:864)
at java.util.Scanner.next(Scanner.java:1485)
at java.util.Scanner.nextInt(Scanner.java:2117)
at java.util.Scanner.nextInt(Scanner.java:2076)
at org.biojava.nbio.ronn.ModelLoader.loadModels(ModelLoader.java:175)
at org.biojava.nbio.ronn.Jronn.<clinit>(Jronn.java:55)
... 1 more
Here is the line *25* which is the same line from the test folder of
biojava github.
float[] rawProbabilityScores = Jronn.getDisorderScores(new
FastaSequence("name", "LLRGRHLMNGTMIMRPWNFLNDHHFPKFFPHLIEQQAIWLADWWRKKHC" +
"RPLPTRAPTMDQWDHFALIQKHWTANLWFLTFPFNDKWGWIWFLKDWTPGSADQAQRACTWFFCHGHDTN" +
"CQIIFEGRNAPERADPMWTGGLNKHIIARGHFFQSNKFHFLERKFCEMAEIERPNFTCRTLDCQKFPWDDP"
));
-------------- next part --------------
An HTML attachment was scrubbed...
URL: <http://mailman.open-bio.org/pipermail/biojava-l/attachments/20170302/0d308f47/attachment.html>
More information about the Biojava-l
mailing list