[EMBOSS] sixpack -orfminsize

[Ed Siefker]

Why do I get protein sequences that are shorter than orfminsize/3 when
I use that option with sixpack?   Do I misunderstand what an ORF is?

ebs15242 at biox:~/Data/EMBOSS$ sixpack -orfminsize 500 kras.gb
Display a DNA sequence with 6-frame translation and ORFs
Output file [nm_004985.sixpack]:
protein output sequence(s) [nm_004985.fasta]:
ebs15242 at biox:~/Data/EMBOSS$ head nm_004985.fasta
>NM_004985_1_ORF1  Translation of NM_004985 in frame 1, ORF 1, threshold 500, 62aa
GRGGGGSSGGGSGGGEGGGGSASTPGPRHFGLGASAAQALKAAAGPEAQRLPGAGERPAE
ND
>NM_004985_1_ORF2  Translation of NM_004985 in frame 1, ORF 2, threshold 500, 31aa
SKICNIFVMNCTTPNYCNVIKIVTVTKKKKX

62aa and 31aa lead to sizes of 186bp and 93bp.  What's happening to
the other  300-400 base pairs in the ORF?  Why are they not getting
translated?