databanks in PIR format

[Guy Bottu]

from : BEN

	Dear colleagues,
	
Has anybody already successfully accessed databanks in PIR NBRF or CODATA format 
under EMBOSS ? 

I have EMBOSS 2.0.0 and a databank in PIR format (the version in NBRF format is 
indexed under SRS). My emboss.default file contains :

DB pir_nr [ type: P format: nbrf comment: 'PIR nonredundant'
            methodquery: srs dbalias: PIR_NR
            methodall: direct dir: /seq/protein/flat file: pir_nr.seq
]

But this does not work. E.g.  seqret pir_nr:e69549  gives an output file :

>E69549 conserved hypothetical protein AF2396 - Archaeoglobus fulgidus
>E69549
MTVVPLSALREGQEGRVVAINGGRGCTARLMSMGIVPGKKIRIAGRRGGAVLVSVNGTKF
VIGRGLAMKVAVDVGEQG

	Guy Bottu