[BioRuby-cvs] bioruby/test/data/bl2seq cd8a_cd8b_blastp.bl2seq, NONE, 1.1 cd8a_p53_e-5blastp.bl2seq, NONE, 1.1
Mitsuteru C. Nakao
nakao at pub.open-bio.org
Mon Feb 13 15:51:13 UTC 2006
Update of /home/repository/bioruby/bioruby/test/data/bl2seq
In directory pub.open-bio.org:/tmp/cvs-serv13903/test/data/bl2seq
Added Files:
cd8a_cd8b_blastp.bl2seq cd8a_p53_e-5blastp.bl2seq
Log Message:
* Newly added.
--- NEW FILE: cd8a_p53_e-5blastp.bl2seq ---
Query= CD8A_HUMAN P01732 T-cell surface glycoprotein CD8 alpha chain
precursor (T-lymphocyte differentiation antigen T8/Leu-2).
(235 letters)
Lambda K H
0.323 0.137 0.436
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 175
Number of Sequences: 0
Number of extensions: 8
Number of successful extensions: 0
Number of sequences better than 1.0e-05: 0
Number of HSP's better than 0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 0
length of query: 235
length of database: 393
effective HSP length: 27
effective length of query: 208
effective length of database: 366
effective search space: 76128
effective search space used: 76128
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 74 (33.1 bits)
--- NEW FILE: cd8a_cd8b_blastp.bl2seq ---
Query= CD8A_HUMAN P01732 T-cell surface glycoprotein CD8 alpha chain
precursor (T-lymphocyte differentiation antigen T8/Leu-2).
(235 letters)
>CD8B_HUMAN P10966 T-cell surface glycoprotein CD8 beta chain
precursor (Antigen CD8B).
Length = 210
Score = 29.6 bits (65), Expect = 5e-05
Identities = 21/90 (23%), Positives = 37/90 (41%), Gaps = 3/90 (3%)
Query: 39 VELKCQVLLSNPTSGCSWLFQ---PRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLG 95
V L C+ +S WL Q P + L+ S E ++ ++ + R
Sbjct: 37 VMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDA 96
Query: 96 DTFVLTLSDFRRENEGYYFCSALSNSIMYF 125
F+L L+ + E+ G YFC + + + F
Sbjct: 97 SRFILNLTSVKPEDSGIYFCMIVGSPELTF 126
Lambda K H
0.323 0.137 0.436
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 102
Number of Sequences: 0
Number of extensions: 5
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 235
length of database: 210
effective HSP length: 22
effective length of query: 213
effective length of database: 188
effective search space: 40044
effective search space used: 40044
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 20 (12.2 bits)
S2: 20 (12.3 bits)
More information about the bioruby-cvs
mailing list