[Biopython] Using the Bio.SeqUtils.ProtParam module
João Rodrigues
anaryin at gmail.com
Fri Jul 23 15:25:47 UTC 2010
Hello Andrew,
Try this: ProtParam.ProteinAnalysis(Sequence)
Best,
João [...] Rodrigues
@ http://doeidoei.wordpress.org
On Fri, Jul 23, 2010 at 5:22 PM, Andrew Maher <amaher at fas.harvard.edu>wrote:
> I'm a beginner with python, and I'm having trouble with something
> relatively
> simple:
>
> I'm trying to find the isoelectric point of a protein with the
> sequence:
> VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPEASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
>
> So, when I load python 2.6.2 with bipython v1.54 and then type in "from
> Bio.SeqUtils import ProtParam" on one line and then "X =
>
> ProteinAnalysis("VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPEASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC")
> on the next line, I get the following error message:
>
> NameError: name 'ProteinAnalysis' is not defined
>
> But, looking at the source code for ProtParam (
>
> http://biopython.org/DIST/docs/api/Bio.SeqUtils.ProtParam-pysrc.html#ProteinAnalysis
> ),
> isn't the ProteinAnalysis class clearly defined? What am I doing wrong?
> _______________________________________________
> Biopython mailing list - Biopython at lists.open-bio.org
> http://lists.open-bio.org/mailman/listinfo/biopython
>
More information about the Biopython
mailing list