[Biopython-dev] [Bug 1942] GenBank RecordParser fails on particular qualifier structure

[bugzilla-daemon at portal.open-bio.org]

http://bugzilla.open-bio.org/show_bug.cgi?id=1942


lpritc at scri.sari.ac.uk changed:

           What    |Removed                     |Added
----------------------------------------------------------------------------
                 CC|                            |lpritc at scri.sari.ac.uk
             Status|RESOLVED                    |REOPENED
         Resolution|DUPLICATE                   |




------- Comment #3 from lpritc at scri.sari.ac.uk  2006-02-09 08:59 -------
The updated CVS code from February 8th falls over on the note qualifier of the
following record from NC_007633.gbk

     CDS             391217..391771
                     /locus_tag="MCAP_0327"
                     /note="Similar non-mycoplasma proteins have and additional

                     120 amino acids at the COOH end; identified by similarity
                     to SP:P54575; match to protein family HMM PF06574"
                     /codon_start=1
                     /transl_table=4
                     /product="riboflavin kinase (flavokinase) domain protein"
                     /protein_id="YP_424312.1"
                     /db_xref="GI:83319941"
                     /db_xref="GeneID:3828958"
                     /translation="MIYINESFNKLKKLNIKKAIITIGNFDGFHIYHQKIINKVIQIA
                     KQENLTSIVMSFDKKIKDNITYTNLATKKQKLDFINNNLSDLDYFFDIKVDDSLIKTT
                     KDQFIDVLINKLNVIKIVEGQDFKFGYLSQGNIDDLIKAFSKKNVIIFKRDNDISSTK
                     IKKLLDENLVDKAQELLGIDLKLK"

Deleting the extra \n in the record resolves the problem.




------- You are receiving this mail because: -------
You are the assignee for the bug, or are watching the assignee.