[Bioperl-l] Barry's challenge
Aaron J. Mackey
amackey at pcbi.upenn.edu
Fri Nov 11 08:01:10 EST 2005
barry.txt is not in FASTA format, it's in raw format
On Nov 10, 2005, at 9:39 PM, Jay Hannah wrote:
> $ cat barry.txt
> MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVA
>
> But then my program (1) sees barry.txt, but isn't reading it...?
--
Aaron J. Mackey, Ph.D.
Project Manager, ApiDB Bioinformatics Resource Center
Penn Genomics Institute, University of Pennsylvania
email: amackey at pcbi.upenn.edu
office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
fax: 215-746-6697
postal: Penn Genomics Institute
Goddard Labs 212
415 S. University Avenue
Philadelphia, PA 19104-6017
More information about the Bioperl-l
mailing list