[Bioperl-l] Barry's challenge

Aaron J. Mackey amackey at pcbi.upenn.edu
Fri Nov 11 08:01:10 EST 2005


barry.txt is not in FASTA format, it's in raw format

On Nov 10, 2005, at 9:39 PM, Jay Hannah wrote:

> $ cat barry.txt
> MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVA
>
> But then my program (1) sees barry.txt, but isn't reading it...?

--
Aaron J. Mackey, Ph.D.
Project Manager, ApiDB Bioinformatics Resource Center
Penn Genomics Institute, University of Pennsylvania
email:  amackey at pcbi.upenn.edu
office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
fax:    215-746-6697
postal: Penn Genomics Institute
         Goddard Labs 212
         415 S. University Avenue
         Philadelphia, PA  19104-6017




More information about the Bioperl-l mailing list