[Bioperl-l] fasta genbank record with gid

[Pedro Antonio Reche]

Hi all,
I am using the following code provided by Jason Stajich to download 
genbank fasta records:
#!/usr/sbin/perl -w
#
# How to retrieve GenBank entries over the Web
#
# by Jason Stajich
#
use Bio::DB::GenPept;
use Bio::SeqIO;
my $gb = new Bio::DB::GenPept;

my $seqout = new Bio::SeqIO(-fh => \*STDOUT, -format => 'fasta');

my $seqio = $gb->get_Stream_by_id([ qw( 18606304 )]);

while( defined ($seq = $seqio->next_seq )) {
        $seqout->write_seq($seq);
}

When I do this I get the following:
 >AAH22894 Thymic stromal lymphopoietin, isoform 2 [Homo sapiens].
MKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

which is nice but I wonder if it will be possible to include the GI 
number in the fasta header so that I would get something like this

 >18606304|AAH22894 Thymic stromal lymphopoietin, isoform 2 [Homo sapiens].
MKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Thanks in advance for any help.
Regards,

pdro