[Biojava-l] Parsing INSDseq Sequences (1.3 & 1.4)

Luba powell_luba at hotmail.com
Tue Jun 6 15:16:44 UTC 2006


Hey, guys,
Do you know how to unsubscribe from the list?

Thanks.

----- Original Message ----- 
From: "Seth Johnson" <johnson.biotech at gmail.com>
To: "Richard Holland" <richard.holland at ebi.ac.uk>
Cc: <biojava-l at lists.open-bio.org>
Sent: Tuesday, June 06, 2006 10:34 AM
Subject: Re: [Biojava-l] Parsing INSDseq Sequences (1.3 & 1.4)


>I think it would be best to wait for the 'official response'.  I could
> only locate the general changes detailed here:
>
> http://www.bio.net/bionet/mm/genbankb/2005-December/000233.html
>
> As far as the solution to the ever changing formats I just don't see
> an elegant way. :(  The only things that comes to mind is creating
> separate format "INSDseq14Format.java" and build new readers & writers
> on top of that.
>
> #1: And on that note I wanted to ask about differences between Genbank
> & INSDseq parsers and a ways to retrieve certain values.  The tutorial
> states that those two formats are essentialy mirror images of each
> other with the latter being an XML.  When parsing Genbank files
> "rs.getIdentifier()" retrieves the GI number, however, when the same
> function is used on RichSequence obtained by parsing INSDseq format, I
> get a 'null' value.  Moreover, I could not even locate that number
> during debugging in the structure of RichSequence object.  Is there a
> bug or GI number should be obtained differently???
>
> #2: Also, what is the best way to obtain "mol_type" value from
> RichSequence object???  The tutorial states that it's
> "getNoteSet(Terms.getMolTypeTerm())".  I guess it' either a simplified
> explanation or something has changed since .getNoteSet() does not take
> any parameters.  I used
> "rs.getAnnotation().asMap().get(Terms.getMolTypeTerm())" and was
> wondering if that's how it was intended to be retrieved.
>
> As always, below is the INSDseq file I tried to parse:
> ================================
> <?xml version="1.0"?>
> <!DOCTYPE INSDSet PUBLIC "-//NCBI//INSD INSDSeq/EN"
> "http://www.ncbi.nlm.nih.gov/dtd/INSD_INSDSeq.dtd">
> <INSDSet>
> <INSDSeq>
>  <INSDSeq_locus>AY069118</INSDSeq_locus>
>  <INSDSeq_length>1502</INSDSeq_length>
>  <INSDSeq_strandedness>single</INSDSeq_strandedness>
>  <INSDSeq_moltype>mRNA</INSDSeq_moltype>
>  <INSDSeq_topology>linear</INSDSeq_topology>
>  <INSDSeq_division>INV</INSDSeq_division>
>  <INSDSeq_update-date>17-DEC-2001</INSDSeq_update-date>
>  <INSDSeq_create-date>15-DEC-2001</INSDSeq_create-date>
>  <INSDSeq_definition>Drosophila melanogaster GH13089 full length
> cDNA</INSDSeq_definition>
>  <INSDSeq_primary-accession>AY069118</INSDSeq_primary-accession>
>  <INSDSeq_accession-version>AY069118.1</INSDSeq_accession-version>
>  <INSDSeq_other-seqids>
>    <INSDSeqid>gb|AY069118.1|</INSDSeqid>
>    <INSDSeqid>gi|17861571</INSDSeqid>
>  </INSDSeq_other-seqids>
>  <INSDSeq_keywords>
>    <INSDKeyword>FLI_CDNA</INSDKeyword>
>  </INSDSeq_keywords>
>  <INSDSeq_source>Drosophila melanogaster (fruit fly)</INSDSeq_source>
>  <INSDSeq_organism>Drosophila melanogaster</INSDSeq_organism>
>  <INSDSeq_taxonomy>Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta;
> Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;
> Ephydroidea; Drosophilidae; Drosophila</INSDSeq_taxonomy>
>  <INSDSeq_references>
>    <INSDReference>
>      <INSDReference_reference>1 (bases 1 to 
> 1502)</INSDReference_reference>
>      <INSDReference_position>1..1502</INSDReference_position>
>      <INSDReference_authors>
>        <INSDAuthor>Stapleton,M.</INSDAuthor>
>        <INSDAuthor>Brokstein,P.</INSDAuthor>
>        <INSDAuthor>Hong,L.</INSDAuthor>
>        <INSDAuthor>Agbayani,A.</INSDAuthor>
>        <INSDAuthor>Carlson,J.</INSDAuthor>
>        <INSDAuthor>Champe,M.</INSDAuthor>
>        <INSDAuthor>Chavez,C.</INSDAuthor>
>        <INSDAuthor>Dorsett,V.</INSDAuthor>
>        <INSDAuthor>Farfan,D.</INSDAuthor>
>        <INSDAuthor>Frise,E.</INSDAuthor>
>        <INSDAuthor>George,R.</INSDAuthor>
>        <INSDAuthor>Gonzalez,M.</INSDAuthor>
>        <INSDAuthor>Guarin,H.</INSDAuthor>
>        <INSDAuthor>Li,P.</INSDAuthor>
>        <INSDAuthor>Liao,G.</INSDAuthor>
>        <INSDAuthor>Miranda,A.</INSDAuthor>
>        <INSDAuthor>Mungall,C.J.</INSDAuthor>
>        <INSDAuthor>Nunoo,J.</INSDAuthor>
>        <INSDAuthor>Pacleb,J.</INSDAuthor>
>        <INSDAuthor>Paragas,V.</INSDAuthor>
>        <INSDAuthor>Park,S.</INSDAuthor>
>        <INSDAuthor>Phouanenavong,S.</INSDAuthor>
>        <INSDAuthor>Wan,K.</INSDAuthor>
>        <INSDAuthor>Yu,C.</INSDAuthor>
>        <INSDAuthor>Lewis,S.E.</INSDAuthor>
>        <INSDAuthor>Rubin,G.M.</INSDAuthor>
>        <INSDAuthor>Celniker,S.</INSDAuthor>
>      </INSDReference_authors>
>      <INSDReference_title>Direct Submission</INSDReference_title>
>      <INSDReference_journal>Submitted (10-DEC-2001) Berkeley
> Drosophila Genome Project, Lawrence Berkeley National Laboratory, One
> Cyclotron Road, Berkeley, CA 94720, USA</INSDReference_journal>
>    </INSDReference>
>  </INSDSeq_references>
>  <INSDSeq_comment>Sequence submitted by: Berkeley Drosophila Genome
> Project Lawrence Berkeley National Laboratory Berkeley, CA 94720 This
> clone was sequenced as part of a high-throughput process to sequence
> clones from Drosophila Gene Collection 1 (Rubin et al., Science 2000).
> The sequence has been subjected to integrity checks for sequence
> accuracy, presence of a polyA tail and contiguity within 100 kb in the
> genome. Thus we believe the sequence to reflect accurately this
> particular cDNA clone. However, there are artifacts associated with
> the generation of cDNA clones that may have not been detected in our
> initial analyses such as internal priming, priming from contaminating
> genomic DNA, retained introns due to reverse transcription of
> unspliced precursor RNAs, and reverse transcriptase errors that result
> in single base changes. For further information about this sequence,
> including its location and relationship to other sequences, please
> visit our Web site (http://fruitfly.berkeley.edu) or send email to
> cdna at fruitfly.berkeley.edu.</INSDSeq_comment>
>  <INSDSeq_feature-table>
>    <INSDFeature>
>      <INSDFeature_key>source</INSDFeature_key>
>      <INSDFeature_location>1..1502</INSDFeature_location>
>      <INSDFeature_intervals>
>        <INSDInterval>
>          <INSDInterval_from>1</INSDInterval_from>
>          <INSDInterval_to>1502</INSDInterval_to>
>          <INSDInterval_accession>AY069118.1</INSDInterval_accession>
>        </INSDInterval>
>      </INSDFeature_intervals>
>      <INSDFeature_quals>
>        <INSDQualifier>
>          <INSDQualifier_name>organism</INSDQualifier_name>
>          <INSDQualifier_value>Drosophila 
> melanogaster</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>mol_type</INSDQualifier_name>
>          <INSDQualifier_value>mRNA</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>strain</INSDQualifier_name>
>          <INSDQualifier_value>y; cn bw sp</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>db_xref</INSDQualifier_name>
>          <INSDQualifier_value>taxon:7227</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>map</INSDQualifier_name>
>          <INSDQualifier_value>39B3-39B3</INSDQualifier_value>
>        </INSDQualifier>
>      </INSDFeature_quals>
>    </INSDFeature>
>    <INSDFeature>
>      <INSDFeature_key>gene</INSDFeature_key>
>      <INSDFeature_location>1..1502</INSDFeature_location>
>      <INSDFeature_intervals>
>        <INSDInterval>
>          <INSDInterval_from>1</INSDInterval_from>
>          <INSDInterval_to>1502</INSDInterval_to>
>          <INSDInterval_accession>AY069118.1</INSDInterval_accession>
>        </INSDInterval>
>      </INSDFeature_intervals>
>      <INSDFeature_quals>
>        <INSDQualifier>
>          <INSDQualifier_name>gene</INSDQualifier_name>
>          <INSDQualifier_value>E2f2</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>note</INSDQualifier_name>
>          <INSDQualifier_value>alignment with genomic scaffold
> AE003669</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>db_xref</INSDQualifier_name>
>          <INSDQualifier_value>FLYBASE:FBgn0024371</INSDQualifier_value>
>        </INSDQualifier>
>      </INSDFeature_quals>
>    </INSDFeature>
>    <INSDFeature>
>      <INSDFeature_key>CDS</INSDFeature_key>
>      <INSDFeature_location>189..1301</INSDFeature_location>
>      <INSDFeature_intervals>
>        <INSDInterval>
>          <INSDInterval_from>189</INSDInterval_from>
>          <INSDInterval_to>1301</INSDInterval_to>
>          <INSDInterval_accession>AY069118.1</INSDInterval_accession>
>        </INSDInterval>
>      </INSDFeature_intervals>
>      <INSDFeature_quals>
>        <INSDQualifier>
>          <INSDQualifier_name>gene</INSDQualifier_name>
>          <INSDQualifier_value>E2f2</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>note</INSDQualifier_name>
>          <INSDQualifier_value>Longest ORF</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>codon_start</INSDQualifier_name>
>          <INSDQualifier_value>1</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>transl_table</INSDQualifier_name>
>          <INSDQualifier_value>1</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>product</INSDQualifier_name>
>          <INSDQualifier_value>GH13089p</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>protein_id</INSDQualifier_name>
>          <INSDQualifier_value>AAL39263.1</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>db_xref</INSDQualifier_name>
>          <INSDQualifier_value>GI:17861572</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>db_xref</INSDQualifier_name>
>          <INSDQualifier_value>FLYBASE:FBgn0024371</INSDQualifier_value>
>        </INSDQualifier>
>        <INSDQualifier>
>          <INSDQualifier_name>translation</INSDQualifier_name>
> 
> <INSDQualifier_value>MYKRKTASIVKRDSSAAGTTSSAMMMKVDSAETSVRSQSYESTPVSMDTSPDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLVKANEGSIDLKAATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRGGGFNNAKDQENYDLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLDIFGDDSVFTIPNYDEEVDIKRNHYELAVSLDNGSAIDIRLVTNQGKSTTNPHDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEHGYSCNPGMKDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPNLENPPLLQLNPPQEDFNFALKSDEGICELFDVQCS</INSDQualifier_value>
>        </INSDQualifier>
>      </INSDFeature_quals>
>    </INSDFeature>
>  </INSDSeq_feature-table>
> 
> <INSDSeq_sequence>AAGAATAGAGGGAGAATGAAAAAAATGACATAAATGGCGGAAAGCAAACCTAGCGCCAACATTCGTATTTTCGTTTAATTTTCGCTCCAAAGTGCAATTAATTCCGGCTTCTTGATCGCTGCATATTGAGTGCAGCCACGCAAAGAGTTACAAGGACAGGAGTATAGTCATCGAGTCGATTGCGGACCATGTACAAGCGCAAAACCGCGAGTATTGTTAAAAGAGACAGCTCCGCAGCGGGCACCACCTCCTCGGCTATGATGATGAAGGTGGATTCGGCTGAGACTTCGGTCCGGTCGCAGAGCTACGAGTCTACACCCGTTAGCATGGACACATCACCGGATCCTCCAACGCCAATCAAGTCTCCGTCGAATTCACAATCGCAATCGCAGCCTGGACAACAGCGCTCCGTGGGCTCACTGGTCCTGCTCACACAGAAGTTTGTGGATCTCGTGAAGGCCAACGAAGGATCCATCGACCTGAAAGCGGCAACCAAAATCTTGGACGTACAGAAGCGCCGAATATACGATATTACCAATGTTTTAGAGGGCATTGGACTAATTGATAAGGGCAGACACTGCTCCCTAGTGCGCTGGCGCGGAGGGGGCTTTAACAATGCCAAGGACCAAGAGAACTACGACCTGGCACGTAGCCGGACTAATCATTTGAAAATGTTGGAGGATGACCTAGACAGGCAACTGGAGTATGCACAGCGCAATCTGCGCTACGTTATGCAGGATCCCTCGAATAGGTCGTATGCATATGTGACACGTGATGATCTGCTGGACATCTTTGGAGATGATTCCGTATTCACAATACCTAATTATGACGAGGAAGTAGATATCAAGCGTAATCATTACGAGCTGGCCGTGTCGCTGGACAATGGCAGCGCAATTGACATTCGCCTGGTGACGAACCAAGGAAAGAGTACTACAAATCCGCACGATGTGGATGGGTTCTTTGACTATC!
> ACCGTCTGGACACGCCCTCACCCTCGACGTCGTCGCACTCCAGCGAGGATGGTAACGCTCCAGCATGCGCGGGGAACGTGATCACCGACGAGCACGGTTACTCGTGCAATCCCGGGATGAAAGATGAGATGAAACTTTTGGAGAACGAGCTGACGGCCAAGATAATCTTCCAAAATTATCTGTCCGGTCATTCGCTGCGGCGATTTTATCCCGATGATCCGAATCTAGAAAACCCGCCGCTGCTGCAGCTGAATCCTCCGCAGGAAGACTTCAACTTTGCGTTAAAAAGCGACGAAGGTATTTGCGAGCTGTTTGATGTTCAGTGCTCCTAACTGTGGAAGGGGATGTACACCTTAGGACTATAGCTACACTGCAACTGGCCGCGTGCATTGTGCAAATATTTATGATTAGTACAATTTTGACTTTGGATTTCTCTATATCGTCTAGAAATTTTTAATTAGTGTAATACCTTGTAATTTCGCAAATAACAGCAAAACCAATAAATTCGTAAATGCAAAAAAAAAAAAAAAAAA</INSDSeq_sequence>
> </INSDSeq>
> </INSDSet>
> ================================
> On 6/6/06, Richard Holland <richard.holland at ebi.ac.uk> wrote:
>> I can't find any document detailing the differences between INSDseq XML
>> versions 1.3 and 1.4, so I've asked the guys over in the data library
>> section here to see if they have one or can produce one for me. They
>> wrote it so they should know!
>>
>> Once I have this I'll get the INSDseq parser up-to-date. (I could go
>> through the DTDs by hand and work it all out manually, but that would
>> take rather longer than I've got time for at the moment!).
>>
>> It's a bit of a pain trying to keep the parsers up-to-date all the time,
>> especially when people start wanting backwards-compatibility. Does
>> anyone have any bright ideas as to how to manage version changes in file
>> formats?
>>
>> cheers,
>> Richard
>>
>> On Mon, 2006-06-05 at 12:28 -0400, Seth Johnson wrote:
>> > I agree with you on that one.  However, the problem might be a little
>> > deeper.  Same '?' appear in the INSDseq format bounded by
>> > <INSDReference_reference> tags and cause the following exception.
>> > This tells me that the '?' are actually values that are being
>> > incorrectly parsed.  Further examination of the .dtd reveals that
>> > INSDseqFormat.java is tailord towards the INSDSeq v. 1.3 whereas the
>> > files I obtain are in the INSDSeq v. 1.4 (which among other things
>> > contain a new tag <INSDReference_position>).  Here're links to both
>> > .dtd's:
>> >
>> > http://www.ebi.ac.uk/embl/Documentation/DTD/INSDSeq_v1.3.dtd.txt
>> >
>> > http://www.ebi.ac.uk/embl/Documentation/DTD/INSDC_V1.4.dtd.txt
>> >
>> > I think it might be worth accommodating changes for the INSDseq
>> > format, not sure how that would affect the '?' in Genbank.
>> >
>> > Seth
>> >
>> > ======================
>> > org.biojava.bio.BioException: Could not read sequence
>> >         at 
>> > org.biojavax.bio.seq.io.RichStreamReader.nextRichSequence(RichStreamReader.java:112)
>> >         at exonhit.parsers.GenBankParser.main(GenBankParser.java:348)
>> > Caused by: org.biojava.bio.seq.io.ParseException:
>> > org.biojava.bio.seq.io.ParseException: Bad reference line found: ?
>> >         at 
>> > org.biojavax.bio.seq.io.INSDseqFormat.readRichSequence(INSDseqFormat.java:250)
>> >         at 
>> > org.biojavax.bio.seq.io.RichStreamReader.nextRichSequence(RichStreamReader.java:109)
>> >         ... 1 more
>> > Caused by: org.biojava.bio.seq.io.ParseException: Bad reference line 
>> > found: ?
>> >         at 
>> > org.biojavax.bio.seq.io.INSDseqFormat$INSDseqHandler.endElement(INSDseqFormat.java:901)
>> >         at 
>> > com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.endElement(AbstractSAXParser.java:633)
>> >         at 
>> > com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanEndElement(XMLDocumentFragmentScannerImpl.java:1241)
>> >         at 
>> > com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl$FragmentContentDispatcher.dispatch(XMLDocumentFragmentScannerImpl.java:1685)
>> >         at 
>> > com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanDocument(XMLDocumentFragmentScannerImpl.java:368)
>> >         at 
>> > com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:834)
>> >         at 
>> > com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:764)
>> >         at 
>> > com.sun.org.apache.xerces.internal.parsers.XMLParser.parse(XMLParser.java:148)
>> >         at 
>> > com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.parse(AbstractSAXParser.java:1242)
>> >         at javax.xml.parsers.SAXParser.parse(SAXParser.java:375)
>> >         at org.biojavax.utils.XMLTools.readXMLChunk(XMLTools.java:97)
>> >         at 
>> > org.biojavax.bio.seq.io.INSDseqFormat.readRichSequence(INSDseqFormat.java:246)
>> >         ... 2 more
>> > Java Result: -1
>> > ======================
>> >
>> > ~~~~~~~~~~~~~~~~~~~~~~
>> > <INSDSeq_references>
>> >     <INSDReference>
>> >       <INSDReference_reference>?</INSDReference_reference>
>> >       <INSDReference_position>1..16732</INSDReference_position>
>> >       <INSDReference_authors>
>> >         <INSDAuthor>Bjornerfeldt,S.</INSDAuthor>
>> >         <INSDAuthor>Webster,M.T.</INSDAuthor>
>> >         <INSDAuthor>Vila,C.</INSDAuthor>
>> >       </INSDReference_authors>
>> >       <INSDReference_title>Relaxation of Selective Constraint on Dog
>> > Mitochondrial DNA Following Domestication</INSDReference_title>
>> >       <INSDReference_journal>Unpublished</INSDReference_journal>
>> >     </INSDReference>
>> >     <INSDReference>
>> >       <INSDReference_reference>?</INSDReference_reference>
>> >       <INSDReference_position>1..16732</INSDReference_position>
>> >       <INSDReference_authors>
>> >         <INSDAuthor>Bjornerfeldt,S.</INSDAuthor>
>> >         <INSDAuthor>Webster,M.T.</INSDAuthor>
>> >         <INSDAuthor>Vila,C.</INSDAuthor>
>> >       </INSDReference_authors>
>> >       <INSDReference_journal>Submitted (06-APR-2006) to the
>> > EMBL/GenBank/DDBJ databases. Evolutionary Biology, Evolutionary
>> > Biology, Norbyvagen 18D, Uppsala 752 36,
>> > Sweden</INSDReference_journal>
>> >     </INSDReference>
>> >   </INSDSeq_references>
>> > ~~~~~~~~~~~~~~~~~~~~~~
>> >
>> > On 6/5/06, Richard Holland <richard.holland at ebi.ac.uk> wrote:
>> > > Hmmm... interesting. I _could_ put in a special case that ignores the
>> > > question marks, but that wouldn't be 'nice' really - this is more of 
>> > > a
>> > > problem with the program that is producing the Genbank files than a
>> > > problem with the parser trying to read them. '?' is not a valid tag 
>> > > in
>> > > the official Genbank format, and has no meaning attached to it that I
>> > > can work out, so I'm reluctant to make the parser recognise it.
>> > >
>> > > I'd suggest you contact the people who write the software you are 
>> > > using
>> > > to produce the Genbank files and ask them if they could stick to the
>> > > rules!
>> > >
>> > > In the meantime you could work around the problem by stripping the
>> > > question marks in some kind of pre-processor before passing it onto
>> > > BioJavaX for parsing.
>> > >
>> > > cheers,
>> > > Richard
>> > >
>> > > On Mon, 2006-06-05 at 11:39 -0400, Seth Johnson wrote:
>> > > > Removing '?' (or several of them in my case) avoids the following 
>> > > > exception:
>> > > > ~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>> > > > org.biojava.bio.BioException: Could not read sequence
>> > > >         at 
>> > > > org.biojavax.bio.seq.io.RichStreamReader.nextRichSequence(RichStreamReader.java:112)
>> > > >         at 
>> > > > exonhit.parsers.GenBankParser.main(GenBankParser.java:348)
>> > > > Caused by: org.biojava.bio.seq.io.ParseException: DQ415957
>> > > >         at 
>> > > > org.biojavax.bio.seq.io.GenbankFormat.readRichSequence(GenbankFormat.java:245)
>> > > >         at 
>> > > > org.biojavax.bio.seq.io.RichStreamReader.nextRichSequence(RichStreamReader.java:109)
>> > > >         ... 1 more
>> > > > Java Result: -1
>> > > > ~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>> > > > I don't know where that previous tokenization problem came from 
>> > > > since
>> > > > I can no longer reproduce it.  This time it's more or less straight
>> > > > forward.
>> > > > Here's the original file with question marks:
>> > > > ============================
>> > > > LOCUS       DQ415957                1437 bp    mRNA    linear   VRT 
>> > > > 01-JUN-2006
>> > > > DEFINITION  Danio rerio capillary morphogenesis protein 2A (cmg2a) 
>> > > > mRNA,
>> > > >             complete cds.
>> > > > ACCESSION   DQ415957
>> > > > VERSION     DQ415957.1  GI:89513612
>> > > > KEYWORDS    .
>> > > > SOURCE      Unknown.
>> > > >   ORGANISM  Unknown.
>> > > >             Unclassified.
>> > > > ?
>> > > > ?
>> > > > FEATURES             Location/Qualifiers
>> > > > ?
>> > > >      gene            1..1437
>> > > >                      /gene="cmg2a"
>> > > >      CDS             1..1437
>> > > >                      /gene="cmg2a"
>> > > >                      /note="cell surface receptor; similar to 
>> > > > anthrax toxin
>> > > >                      receptor 2 (ANTXR2, ATR2, CMG2)"
>> > > >                      /codon_start=1
>> > > >                      /product="capillary morphogenesis protein 2A"
>> > > >                      /protein_id="ABD74633.1"
>> > > >                      /db_xref="GI:89513613"
>> > > > 
>> > > > /translation="MTKENLWSVATTATLFFCLCFSSFKAETPSCHGAYDLYFVLDRS
>> > > > 
>> > > > GSVSTDWSEIYDFVKNLTERFVSPNLRVSFIVFSSRAEIVLPLTGDRSEINKGLKTLS
>> > > > 
>> > > > EVNPAGETYMHEGIKLATEQMKKEPKKSSSIIVALTDGKLETYIHQLTIDEADSARKY
>> > > > 
>> > > > GARVYCVGVKDFDEEQLADVADSKEQVFPVKGGFQALKGIVNSILKQSCTEILTVEPS
>> > > > 
>> > > > SVCVNQSFDIVLRGNGFAVGRQTEGVICSFIVDGVTYKQKPTKVKIDYILCPAPVLYT
>> > > > 
>> > > > VGQQMEVLISLNSGTSYITSAFIITASSCSDGTVVAIVFLVLFLLLALALMWWFWPLC
>> > > > 
>> > > > CTVVIKDPPPQRPPPPPPKLEPDPEPKKKWPTVDASYYGGRGAGGIKRMEVRWGEKGS
>> > > > 
>> > > > TEEGARLEMAKNAVVSIQEESEEPMVKKPRAPAQTCHQSESKWYTPIRGRLDALWALL
>> > > >                      RRQYDRVSVMRPTSADKGRCMNFSRTQH"
>> > > > ORIGIN
>> > > >         1 atgacaaagg aaaatctctg gagcgtggca accacggcga ctcttttctt 
>> > > > ctgtttatgc
>> > > >        61 ttttcatctt ttaaagcgga aaccccatct tgtcatggtg cctacgacct 
>> > > > gtactttgtg
>> > > >       121 ttggaccgat ctggaagtgt ttcgactgac tggagtgaaa tctatgactt 
>> > > > tgtcaaaaat
>> > > >       181 cttacagaga gatttgtgag tccaaatctg cgagtgtcct tcattgtttt 
>> > > > ttcatcaaga
>> > > >       241 gcagagattg tgttaccgct cactggagac aggtcagaaa ttaataaagg 
>> > > > cctgaagacc
>> > > >       301 ttaagtgagg tcaatccagc tggagaaaca tacatgcatg aaggaattaa 
>> > > > attggcaact
>> > > >       361 gaacaaatga aaaaagagcc taaaaagtcc tctagtatta ttgtggcctt 
>> > > > gactgatgga
>> > > >       421 aagcttgaaa cgtatatcca tcaactcact attgacgagg ctgattcagc 
>> > > > aaggaagtat
>> > > >       481 ggggctcgtg tgtactgtgt tggtgtaaaa gactttgatg aagaacagct 
>> > > > agccgatgtg
>> > > >       541 gctgattcca aggagcaagt gttcccagtc aaaggaggct ttcaggctct 
>> > > > caaaggcatc
>> > > >       601 gttaactcga tcctcaagca atcatgcacc gaaatcctaa cagtggaacc 
>> > > > gtccagcgtc
>> > > >       661 tgcgtgaacc agtcctttga cattgttttg agagggaacg ggttcgcagt 
>> > > > ggggagacaa
>> > > >       721 acagaaggag tcatctgcag tttcatagtg gatggagtta cttacaaaca 
>> > > > aaaaccaacc
>> > > >       781 aaagtgaaga ttgactacat cctatgtcct gctccagtgc tgtatacagt 
>> > > > tggacagcaa
>> > > >       841 atggaggttc tgatcagttt gaacagtgga acatcatata tcaccagtgc 
>> > > > tttcatcatc
>> > > >       901 actgcctctt catgttcgga cggcacagtg gtggccattg tgttcttggt 
>> > > > gctttttctc
>> > > >       961 ctgttggctt tggctctgat gtggtggttc tggcctctat gctgcactgt 
>> > > > cgttattaaa
>> > > >      1021 gacccacctc cacaaagacc tcctccacct ccacctaagc tagagccaga 
>> > > > cccggaaccc
>> > > >      1081 aagaagaagt ggccaactgt ggatgcatct tactatgggg gaagaggagc 
>> > > > tggtggaatc
>> > > >      1141 aaacgcatgg aggtccgttg gggagaaaaa gggtctacag aggaaggtgc 
>> > > > aagactagag
>> > > >      1201 atggctaaga atgcagtagt gtcaatacaa gaggaatcag aagaacccat 
>> > > > ggtcaaaaag
>> > > >      1261 ccaagagcac ctgcacaaac atgccatcaa tctgaatcca agtggtatac 
>> > > > accaatcaga
>> > > >      1321 ggccgtcttg acgcactgtg ggctcttttg cggcggcaat atgaccgagt 
>> > > > ttcagttatg
>> > > >      1381 cgaccaactt ctgcagataa gggtcgctgt atgaatttca gtcgcacgca 
>> > > > gcattaa
>> > > > //
>> > > >
>> > > > ============================
>> > > >
>> > > >
>> > > > On 6/5/06, Richard Holland <richard.holland at ebi.ac.uk> wrote:
>> > > > > Hi again.
>> > > > >
>> > > > > Could you remove the offending question mark from the GenBank 
>> > > > > file and
>> > > > > try it again to see if that fixes it? The parser should just 
>> > > > > ignore it
>> > > > > but apparently not. The error looks weird to me because the 
>> > > > > tokenization
>> > > > > for a DNA GenBank file _does_ contain the letter 't'! Not sure 
>> > > > > what's
>> > > > > going on here.
>> > > > ...
>> > > > >
>> > > > > cheers,
>> > > > > Richard
>> > > > >
>> > > > > On Mon, 2006-06-05 at 10:37 -0400, Seth Johnson wrote:
>> > > > > > Hell again Richard,
>> > > > > >
>> > > > > > No sooner I've said about the fix of the last parsing exception 
>> > > > > > than
>> > > > > > another one came up with Genbank format:
>> > > > > > --------------------------------------
>> > > > > > org.biojava.bio.seq.io.ParseException: DQ431065
>> > > > > > org.biojava.bio.BioException: Could not read sequence
>> > > > > >         at 
>> > > > > > org.biojavax.bio.seq.io.RichStreamReader.nextRichSequence(RichStreamReader.java:112)
>> > > > > >         at 
>> > > > > > exonhit.parsers.GenBankParser.getGBSequences(GenBankParser.java:151)
>> > > > > >         at 
>> > > > > > exonhit.parsers.GenBankParser.runGBparser(GenBankParser.java:246)
>> > > > > >         at 
>> > > > > > exonhit.parsers.GenBankParser.main(GenBankParser.java:326)
>> > > > > > Caused by: org.biojava.bio.seq.io.ParseException: DQ431065
>> > > > > >         at 
>> > > > > > org.biojavax.bio.seq.io.GenbankFormat.readRichSequence(GenbankFormat.java:245)
>> > > > > >         at 
>> > > > > > org.biojavax.bio.seq.io.RichStreamReader.nextRichSequence(RichStreamReader.java:109)
>> > > > > >         ... 3 more
>> > > > > > org.biojava.bio.seq.io.ParseException:
>> > > > > > org.biojava.bio.symbol.IllegalSymbolException: This 
>> > > > > > tokenization
>> > > > > > doesn't contain character: 't'
>> > > > > > ----------------------------------------
>> > > > > > The Genbank file that caused it is as follows:
>> > > > > > =========================================
>> > > > > > LOCUS       DQ431065                 425 bp    DNA     linear 
>> > > > > > INV 01-JUN-2006
>> > > > > > DEFINITION  Reticulitermes sp. ALS-2006c 16S ribosomal RNA 
>> > > > > > gene, partial
>> > > > > >             sequence; mitochondrial.
>> > > > > > ACCESSION   DQ431065
>> > > > > > VERSION     DQ431065.1  GI:90102206
>> > > > > > KEYWORDS    .
>> > > > > > SOURCE      Vaccinium corymbosum
>> > > > > >   ORGANISM  Vaccinium corymbosum
>> > > > > >             Eukaryota; Viridiplantae; Streptophyta; 
>> > > > > > Embryophyta; Tracheophyta;
>> > > > > >             Spermatophyta; Magnoliophyta; eudicotyledons; core 
>> > > > > > eudicotyledons;
>> > > > > >             asterids; Ericales; Ericaceae; Vaccinioideae; 
>> > > > > > Vaccinieae;
>> > > > > >             Vaccinium.
>> > > > > > ?
>> > > > > > REFERENCE   2  (bases 1 to 425)
>> > > > > >   AUTHORS   Naik,L.D. and Rowland,L.J.
>> > > > > >   TITLE     Expressed Sequence Tags of cDNA clones from 
>> > > > > > subtracted library of
>> > > > > >             Vaccinium corymbosum
>> > > > > >   JOURNAL   Unpublished (2005)
>> > > > > > FEATURES             Location/Qualifiers
>> > > > > >      source          1..425
>> > > > > >                      /organism="Vaccinium corymbosum"
>> > > > > >                      /mol_type="genomic DNA"
>> > > > > >                      /cultivar="Bluecrop"
>> > > > > >                      /db_xref="taxon:69266"
>> > > > > >                      /tissue_type="Flower buds"
>> > > > > >                      /clone_lib="Subtracted cDNA library of 
>> > > > > > Vaccinium
>> > > > > >                      corymbosum"
>> > > > > >                      /dev_stage="399 hour chill unit exposure"
>> > > > > >                      /note="Vector: pCR4TOPO; Site_1: Eco R I; 
>> > > > > > Site_2: Eco R I"
>> > > > > >      rRNA            <1..>425
>> > > > > >                      /product="16S ribosomal RNA"
>> > > > > > ORIGIN
>> > > > > >         1 cgcctgttta tcaaaaacat cttttcttgt tagtttttga 
>> > > > > > agtatggcct gcccgctgac
>> > > > > >        61 tttagtgttg aagggccgcg gtattttgac cgtgcaaagg 
>> > > > > > tagcatagtc attagttctt
>> > > > > >       121 taattgtgat ctggtatgaa tggcttgacg aggcatgggc 
>> > > > > > tgtcttaatt ttgaattgtt
>> > > > > >       181 tattgaattt ggtctttgag ttaaaattct tagatgtttt 
>> > > > > > tatgggacga gaagacccta
>> > > > > >       241 tagagtttaa catttattat ggtccttttc tgtttgtgag 
>> > > > > > ggctcactgg gccgtctaat
>> > > > > >       301 atgttttgtt ggggtgatgg gagggaataa tttaacccct 
>> > > > > > cctttttatt attatattta
>> > > > > >       361 tttatattta tttgatccat ttattttgat tgtaagatta 
>> > > > > > aattacctta gggataacag
>> > > > > >       421 cgtaa
>> > > > > > //
>> > > > > > ==================================
>> > > > > > I think it's the presence of the '?' at the beginning of the 
>> > > > > > line?!?!
>> > > > > > I'm not sure wether the information that was supposed to be 
>> > > > > > present
>> > > > > > instead of those question marks is absent from the original 
>> > > > > > ASN.1
>> > > > > > batch file or it's a bug in the NCBI ASN2GO software.  It looks 
>> > > > > > to me
>> > > > > > that the former is the case since the file from NCBI website 
>> > > > > > contains
>> > > > > > much more information than the batch file. Just bringing this 
>> > > > > > to
>> > > > > > everyone's attention.
>> > > > > >
>> > > > > >
>> > > > > > --
>> > > > > > Best Regards,
>> > > > > >
>> > > > > >
>> > > > > > Seth Johnson
>> > > > > > Senior Bioinformatics Associate
>> > > > > >
>> > > > > > Ph: (202) 470-0900
>> > > > > > Fx: (775) 251-0358
>> > > > > >
>> > > > > > On 6/2/06, Richard Holland <richard.holland at ebi.ac.uk> wrote:
>> > > > > > > Hi Seth.
>> > > > > > >
>> > > > > > > Your second point, about the authors string not being read 
>> > > > > > > correctly in
>> > > > > > > Genbank format, has been fixed (or should have been if I got 
>> > > > > > > the code
>> > > > > > > right!). Could you check the latest version of biojava-live 
>> > > > > > > out of CVS
>> > > > > > > and give it another go? Basically the parser did not 
>> > > > > > > recognise the
>> > > > > > > CONSRTM tag, as it is not mentioned in the sample record 
>> > > > > > > provided by
>> > > > > > > NCBI, which is what I based the parser on.
>> > > > > > ...
>> > > > > > >
>> > > > > > > cheers,
>> > > > > > > Richard
>> > > > > > >
>> > > > > > >
>> > > > > --
>> > > > > Richard Holland (BioMart Team)
>> > > > > EMBL-EBI
>> > > > > Wellcome Trust Genome Campus
>> > > > > Hinxton
>> > > > > Cambridge CB10 1SD
>> > > > > UNITED KINGDOM
>> > > > > Tel: +44-(0)1223-494416
>> > > > >
>> > > > >
>> > > >
>> > > >
>> > > --
>> > > Richard Holland (BioMart Team)
>> > > EMBL-EBI
>> > > Wellcome Trust Genome Campus
>> > > Hinxton
>> > > Cambridge CB10 1SD
>> > > UNITED KINGDOM
>> > > Tel: +44-(0)1223-494416
>> > >
>> > >
>> >
>> >
>> --
>> Richard Holland (BioMart Team)
>> EMBL-EBI
>> Wellcome Trust Genome Campus
>> Hinxton
>> Cambridge CB10 1SD
>> UNITED KINGDOM
>> Tel: +44-(0)1223-494416
>>
>>
>
>
> -- 
> Best Regards,
>
>
> Seth Johnson
> Senior Bioinformatics Associate
>
> Ph: (202) 470-0900
> Fx: (775) 251-0358
>
> _______________________________________________
> Biojava-l mailing list  -  Biojava-l at lists.open-bio.org
> http://lists.open-bio.org/mailman/listinfo/biojava-l
> 



More information about the Biojava-l mailing list