<html><body>
<p><font size="2" face="sans-serif">I would like to convert a gff file (which I recieved on converting a sequence in Genbank format using bioperl) in table e.g. like the following one:</font><br>
<br>
<font size="2" face="sans-serif">Seqname Source feature Start End Score Strand Frame Attributes</font><br>
<font size="2" face="sans-serif">chr1 hg19_gold exon 67088326 67183780 0,000000 + . gene_id "AL139147.7"; transcript_id "AL139147.7"</font><br>
<br>
<font size="2" face="sans-serif">In my gff file you will observe the following :</font><br>
<br>
<font size="2" face="sans-serif">Lines are doubled i.e repeated e.g. </font><br>
<br>
<br>
<tt><font size="3">CP008802 Genbank gene 417 638 . + . ID=FB03_00010<br>
CP008802 Genbank CDS 417 638 . + .<br>
Parent=FB03_00010.t00;db_xref=EnsemblGenomes-Gn%3AFB03_00010,EnsemblGenomes-Tr%3AAIE81925,UniProtKB%2FTrEMBL%3AA0A068NGQ6;codon_start=1;inference=COORDINATES%3Aab%20initio%20prediction%3AGeneMarkS%2B;product=hypothetical%20protein;translation=MAKRKKKDRGGVLTWVGIFAIVLASIADFVLFFFDNGSRYILYTLPLWFLGIGCFAWLGRAEERRNNTKRTGN;transl_table=11;note=Derived%20by%20automated%20computational%20analysis%20using%20gene%20prediction%20method%3A%20GeneMarkS%2B.;protein_id=AIE81925.1</font></tt><br>
<tt><font size="3"><br>
</font></tt></body></html>