[Bioperl-l] help needed: EXCEPTION error

[Beth Kidd]

 I have created a web interface for the PDB website as part of a larger
 project and I am using BioPerl for parts of this process. It seems to work
 fine from the web page. But when I run the same thing at the command line I
 am getting errors from the package. Here are the errors:

 -------------------- EXCEPTION --------------------

 MSG: Can't parse entry

[QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQ

NPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYV

LFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSR
 AIFGEAEAPEPSAGDGAAATS]

 STACK Bio::SeqIO::fasta::next_primary_seq
 /usr/lib/perl5/site_perl/5.6.0/i386-linux/Bio/SeqIO/fasta.pm:110

 STACK Bio::SeqIO::fasta::next_seq
 /usr/lib/perl5/site_perl/5.6.0/i386-linux/Bio/SeqIO/fasta.pm:85

 STACK toplevel ./run_blast_remote.pl:121-

 Can anyone translate for me? The brackets originate from the error message,
 not input. Why would I be getting this error message? It doesn't make sense
 that the problem would be with the sequence and it only happens at the
 command line. I am only trying to submit only one sequence. Please forgive
me if this seems simple or unclear. I'm new to this project.

 Beth Kidd